SecReT6
Protein ID: 387609983
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4568
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4897767..4898699 [+]
Productputative type VI secretion protein
NoteTssG
UniProt IDD3GUZ4
KEGG IDelo:EC042_4568
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-53, Aligned region: 7..296
Protein Sequence: 310 a.a.     [Download]
>gi|387609983|ref|YP_006098839.1| putative type VI secretion protein [Escherichia coli 042]
MALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEKDGKYHLTLF
DNGLTGATGILPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENRRDNNVLNNV
LLSLGGITPQTVSVTGLAYVAFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSEQGVLGNCLY
TLGEGPVIGNVRWVVDSHFDVVLGPVDYRKAQELMPGKDSHYFIRQQIRSYIGDVLKFKIYVKIYPGNND
NQLNINNKLGFNLSLGSETENYKERCFCIF
 
Nucleotide Sequence: 933 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4897767-4898699 Escherichia coli 042, complete genome
ATGGCTTTGATTAATAACCGGAGTAAATTCAGCTTTTTCAATAAAGTCCGTGTGTTATTGAAAAATATTC
TGAAACCAGATGAAAGCGTTGAAGACGTTGTTGATGAACATTTCAGATTTACATCAAGTCTGTCTTTAGA
TGCACCTGACGGTCAGATAGAGAACCTGTATCAGGATGAGAAGGACGGAAAGTATCATCTCACATTATTC
GATAATGGATTAACCGGGGCTACAGGGATTCTTCCTGCCGCATATACAGAATGGCTGATTGAAAGGAAAT
TACGTTATAATGATGACGCTCCTAAGGCATTCATGGACATGTTTGACCATAGAATGTATTGTCTTTCTTA
TCTCGCATGGCAAAAAATGCATCTGTCAGGAGATGAAAACAGAAGGGATAATAATGTTCTTAACAATGTT
CTTTTATCTTTAGGCGGGATCACTCCTCAGACAGTTAGTGTGACAGGTCTGGCATACGTTGCATTCTATT
CACAACCAGTAAGATCCCTGGCCGGGCTTGAGCAGTTACTCTCGTTAATACATCAAATCAGAGTGTCCAT
TAATCCTTTTCGTGGCACTTTTGAAAATACAGAACCCAGTGAGCAGGGGGTTCTGGGGAATTGCCTCTAT
ACTCTGGGGGAAGGTCCTGTCATAGGCAATGTTCGTTGGGTGGTTGATTCACATTTTGATGTTGTATTGG
GGCCTGTGGACTATAGAAAAGCACAGGAACTTATGCCGGGAAAAGATTCCCACTATTTTATCAGACAACA
AATAAGATCGTATATAGGTGATGTTCTTAAGTTCAAAATATATGTGAAAATCTATCCCGGTAACAATGAT
AATCAACTTAATATAAACAATAAGCTTGGTTTCAATCTTTCACTCGGTTCTGAAACAGAAAATTATAAAG
AACGGTGCTTTTGTATATTTTGA