SecReT6
Protein ID: 387609984
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4569
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4898712..4900694 [+]
Productputative type VI secretion protein
NoteTssI
UniProt IDD3GUZ5
KEGG IDelo:EC042_4569
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-36, Aligned region: 38..318
Phage_base_V [PF04717], Evalue: 1.70E-21, Aligned region: 367..459
Phage_base_V [PF04717], Evalue: 1.70E-21, Aligned region: 463..481
DUF2345 [PF10106], Evalue: 0.00028, Aligned region: 495..630
Protein Sequence: 660 a.a.     [Download]
>gi|387609984|ref|YP_006098840.1| putative type VI secretion protein [Escherichia coli 042]
MTRQRFISDDHYKFQSEHFIRLHGCDISLFPLEIKGKESISDVYSYEIKCFSRTDHNSLDKLHGTRLSCE
IGEQYNSLPARFIHGVVTKVIYNYDNSMQHTCIIILQPEIAELASGKRTRVWSNIKPSDIVSTILEDSLF
SPPQVILYKEQNLLEYKIQYQESDLDFINRILSEAGIYYFFVHNRDKHIMTLADDPASHPKASYDKLEHL
PCENLKESRHGYIREWSFTESLKCPSVTLSGYNESNVSEITIKSESKLTDVKPSKGVYEDIIPERKRELI
KKRSEALIASCDSELKIWSGKTDSWWLSCGECFSLDKQDYRITSLYLNAVNNDNEHAGLCYCDLCASDNK
SSLNFSREFKTPIIPGVLLARVVGPDSEEYYTDDNGRVKISFLWGEKSAAGTDKTSCWVRVSQVWSGEGF
GSQFIPRIGSEVLVSFIQGNPDYPVIVGTVYNGQNTSPFSLPENNCKSGFITRSVKNGKKGEGHQLVFDD
KEGEEKVIVTSSGDSLLTVKKDMISTINRSMSLTIAEGRNAEIKRGNDRLVLKEGDLHNDVHGNINIKVS
NGDYNLKVSGGSGSLITDKNLTLESTQSIKIKVGANEITISTSGIDIKAAKITIEGQVSAEVKAATLKFE
SQAISEVKGTMLTLQGSAMTQIKGGIVNIG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4898712-4900694 Escherichia coli 042, complete genome
ATGACTAGGCAAAGATTTATATCTGACGATCATTATAAATTCCAGAGTGAACATTTTATCCGGTTGCACG
GCTGTGATATATCATTATTTCCACTTGAGATTAAAGGTAAAGAGTCAATATCTGATGTATATAGTTATGA
AATAAAATGCTTTAGTAGGACCGACCACAACTCTCTGGATAAGTTACACGGCACGCGTTTGAGTTGTGAG
ATCGGGGAACAATACAATTCGTTACCTGCGCGCTTCATTCATGGTGTGGTCACAAAAGTGATATATAATT
ATGATAACAGCATGCAACATACCTGCATTATTATCTTACAACCAGAGATAGCCGAATTGGCATCTGGTAA
AAGAACAAGAGTATGGTCAAATATAAAGCCATCAGATATTGTAAGCACAATTCTGGAAGACAGTTTATTT
AGTCCGCCACAAGTAATTTTATATAAAGAACAGAATTTGCTGGAGTATAAGATCCAGTACCAGGAGTCAG
ATCTTGACTTTATTAATAGAATTTTGTCTGAGGCGGGCATTTACTATTTCTTTGTTCATAATAGAGATAA
ACATATTATGACATTGGCAGATGATCCTGCATCTCATCCTAAAGCATCTTATGATAAACTGGAACACTTA
CCCTGTGAAAATCTGAAGGAATCGCGTCATGGCTATATCAGGGAATGGTCTTTCACAGAAAGTCTCAAAT
GTCCTTCTGTGACACTTTCAGGTTATAATGAGAGTAATGTCAGTGAAATTACTATAAAGTCAGAAAGTAA
ACTGACGGATGTAAAACCCAGTAAGGGAGTTTATGAAGATATTATCCCAGAGAGAAAGCGTGAGTTGATA
AAGAAACGTTCTGAAGCACTGATAGCATCATGTGACAGTGAACTCAAAATCTGGTCAGGAAAAACGGATT
CATGGTGGTTGTCATGCGGGGAGTGTTTCAGTCTGGACAAACAGGATTACAGAATTACTTCGTTATATCT
TAATGCTGTCAACAATGACAATGAACATGCTGGTTTGTGTTATTGTGATTTGTGTGCTTCAGATAATAAA
AGCTCACTTAATTTCAGCCGTGAATTTAAAACACCTATTATTCCCGGTGTTTTACTTGCCAGAGTGGTCG
GTCCTGACTCCGAAGAATATTATACAGATGATAATGGGCGTGTAAAAATCAGCTTTCTCTGGGGAGAAAA
GTCAGCGGCAGGTACAGATAAAACCTCCTGTTGGGTCCGTGTATCTCAGGTATGGTCCGGGGAGGGATTC
GGTAGTCAGTTTATTCCTCGCATTGGCAGTGAGGTTCTGGTTAGTTTTATACAGGGTAATCCTGACTATC
CAGTTATCGTTGGTACAGTGTATAATGGTCAGAATACATCGCCTTTTTCTCTTCCTGAGAATAATTGTAA
GTCTGGATTTATCACCCGTAGTGTTAAGAATGGTAAAAAAGGAGAAGGTCATCAACTGGTTTTTGATGAT
AAAGAAGGTGAGGAAAAAGTTATAGTGACTTCATCTGGTGATTCTCTCCTGACTGTAAAGAAGGATATGA
TCAGCACTATTAACCGCTCTATGTCGTTAACTATTGCTGAAGGGCGTAATGCTGAAATAAAAAGAGGGAA
TGACAGGCTTGTTCTTAAAGAAGGTGACCTACATAATGATGTACATGGTAATATTAATATAAAAGTTTCG
AACGGAGATTATAATCTTAAAGTGAGCGGGGGAAGTGGTAGTCTTATCACCGATAAGAATCTTACTCTTG
AATCAACACAGTCAATAAAAATAAAAGTGGGTGCAAATGAGATAACGATATCCACATCAGGTATAGATAT
AAAAGCCGCTAAAATTACTATAGAAGGGCAGGTATCGGCAGAGGTCAAAGCGGCCACACTTAAGTTTGAA
AGCCAGGCTATTTCTGAGGTAAAAGGCACCATGTTGACGCTTCAGGGCTCTGCAATGACACAGATAAAAG
GTGGAATCGTGAATATAGGATAA