SecReT6
Protein ID: 387609986
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4571
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4901182..4901481 [+]
Productputative type VI secretion protein
NotePAAR
UniProt IDD3GUZ7, D3GUZ7
KEGG IDelo:EC042_4571
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-20, Aligned region: 3..17
PAAR_motif [PF05488], Evalue: 3.10E-20, Aligned region: 24..92
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 34..51
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 57..85
PAAR_motif [PF05488], Evalue: 3.10E-20, Aligned region: 3..17
PAAR_motif [PF05488], Evalue: 3.10E-20, Aligned region: 24..92
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 34..51
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 57..85
Protein Sequence: 99 a.a.     [Download]
>gi|387609986|ref|YP_006098842.1| putative type VI secretion protein [Escherichia coli 042]
MPQPAARVTDMHVCPMVTPGLPPVPHVGGPLLPPGSPSVFIGGLPAATLGTLALCSGPVDVVIMGSVKVL
ICGKPAARMGDICAHGGTIVSGYPQVLIG
 
Nucleotide Sequence: 300 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4901182-4901481 Escherichia coli 042, complete genome
ATGCCTCAACCTGCTGCAAGAGTTACTGATATGCATGTATGTCCTATGGTGACGCCTGGTTTACCACCTG
TTCCCCATGTTGGGGGGCCATTGTTACCACCAGGCTCTCCGTCTGTATTTATTGGTGGATTACCGGCAGC
GACATTGGGGACCCTGGCTCTTTGTTCTGGGCCAGTGGATGTTGTCATTATGGGAAGTGTTAAGGTCTTG
ATATGCGGCAAACCAGCTGCACGAATGGGCGATATCTGTGCTCACGGAGGGACAATTGTCAGTGGATATC
CTCAGGTATTAATAGGATGA