SecReT6
Protein ID: 387609987
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4572
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4901485..4902561 [+]
Productputative type VI secretion protein
NoteTssA
UniProt IDD3GUZ8
KEGG IDelo:EC042_4572
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-22, Aligned region: 57..117
Protein Sequence: 358 a.a.     [Download]
>gi|387609987|ref|YP_006098843.1| putative type VI secretion protein [Escherichia coli 042]
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLR
NKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLK
AYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLP
DKIDEIESSYFFHTHEDIHHIFAKTRHIISEITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEK
KEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSME
QINRVLKG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4901485-4902561 Escherichia coli 042, complete genome
ATGAACAAAATAGAAACGGATACATTACTGCTTCCTGTTATAGGAGAATCGCCGGCAGGTGATGATATTG
AGTATGATCCGGTGTATAGCGAAATACGGGAGGCAAGACAAAATGATCCGGACTATATGTCTCAGGGGGA
ATGGGCTGTCAGTGAACCCCGCAGAGCTGACTGGAGAAAAGTAAGAAAATTATGTGAGGTTACTTTACGT
AATAAGAGTAAGGACCTACAAATTAGTTGCTGGTATGTGGAGTCCTTGACGCATTTATATGCTCTGGAAG
GGATGCATTGCGGATTGGAATATCTTGCAAAGTTTATTTCTCAGTACTGGACTACATGCTGGCCATCGCA
GGAAGAAGGTCAGGAAATTCGTTACAGTAAATTGGTTCGTCTTGATATAGATTTATCAGAGTATCTGAAA
GCATATCCTCTTCTTGAGGATAAGGAAATCACACTTTCTGAATGGTATAAGGTGTTATCGTTTGAACATG
GAGCAAGTTTGTCAGAAGCTGGAAAAGAAAGATTAATAGAGAGCGAAGGTGATCACTCTGTTGAGTCCTT
CAAAAGAGCTGTAGGAAAATATAATCCCCGCAAGGTTAGTGAGCAACTTCTCCAGCTTTATGATCTACCT
GACAAAATTGATGAGATTGAATCTTCTTACTTCTTTCATACGCATGAAGATATACATCATATTTTCGCAA
AAACCAGACATATCATCAGTGAGATAACCGAGTTACTGAGTCGTTTTTTGCCGCAAGAAACACTGGATCA
CAGTTCAGTTTCTCAATTTCTAGGCAAACCCGATAGCAGAGACACAAGGACAGCACTTCCTGAGGAGAAA
AAGGAATTTTATTCTGCATTAACACCCTCAACAGATAAAGAGATGTCAAGGGAGAAAGCTATAGAGCAAC
TGGAGAAAATAGCTATTTTTTTCAGGCAATCTGAACCAACCAGTCCTGTTCCTTATCTTCTGGAGAGGGC
CATACGTTGGTCAACAATGACTATGTCAGAATGGCTTGAGGAACTACTTAAAGATAATGACTCTATGGAA
CAAATAAACCGTGTCTTAAAAGGATGA