SecReT6
Protein ID: 387609988
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4573
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4902569..4903120 [+]
Productputative type VI secretion protein
NoteTssJ
UniProt IDD3GUZ9
KEGG IDelo:EC042_4573
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.40E-18, Aligned region: 15..152
Protein Sequence: 183 a.a.     [Download]
>gi|387609988|ref|YP_006098844.1| putative type VI secretion protein [Escherichia coli 042]
MTIKCLLLAVMVCPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFL
QASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVVAGYYPFPGK
QHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4902569-4903120 Escherichia coli 042, complete genome
ATGACTATTAAGTGCCTGCTACTAGCGGTTATGGTATGCCCCTTTTTCATCACTGCCTGTTCTGATAAGT
ATTCTGAACAGGATAGAGTGCAGGCTATCAACAATGCCGATGCTCCATTTGGCGCCGGCTTGCTTACTTT
TCAGATATCATCTGATACGCAATTAAACTCACTTAACGAGATATCCAACAGCTGTGCATTATTATTCTTA
CAGGCTTCAGATAAAAATACATTACAGGACATAATGAATAATCCTGTGTTAATCAAACAGTTTTTTATCG
GGACAGGTAAGGTTGATGGCATTCTTAAAGTTGATAAATACGTGGCTATGCCGGGGCAGGAGATAACGCT
ACATATAGACAGGAATGAAGGGACTAAATATGTAGGTGTGGTTGCTGGATACTATCCATTTCCTGGAAAA
CAGCATATGTTACTCTTAGATATTCCGGTTGATGTTGTTGAGGAAGGTTGGTGGAATAAATCATTACATG
CATCACTCTTACCTCTTTCCAAAAAGATATCGATGGGTAAAGAAAGTATCAGTATGAAATAA