SecReT6
Protein ID: 387609989
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4574
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4903139..4904551 [+]
Productputative type VI secretion protein
NoteTssK
UniProt IDD3GV00
KEGG IDelo:EC042_4574
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-64, Aligned region: 20..446
Protein Sequence: 470 a.a.     [Download]
>gi|387609989|ref|YP_006098845.1| putative type VI secretion protein [Escherichia coli 042]
MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVEKIKAVL
SSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDERNMRNV
YHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKLRNKIAE
IYSDIKFYKNRLEKYRYTERTVSDGHLYNFLILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEIST
FHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEYGAGSNS
DYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKIDKHSEL
WTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4903139-4904551 Escherichia coli 042, complete genome
ATGCAAGAAGAAGAACAACTTGTTTATTGGTATTCAGGGCTCTATTTACAACCTCAGCACTTTCAGTCAA
TTGACTTGCATCATGGCTTCATGCTTGCCAGAAGCAGGCAGTTATCACAACCCCATCATCAGGGGTACTA
TGAATGTTGTATCAATGATGATCTTCTTAAGGAAGATACTGTCAGAGTTGAAAAAATAAAGGCTGTTTTA
TCTTCAGGGTATTATATCGAGTATCCGGGTAACTGTGTGGTACAGGATAAGTGCCTGACAAATCTCAAAG
GTTCAGATCACGGTACCGTGGATTTGTGGCTTGCGCTTAAGAGATTCAATTCCGGTCATAAAAATGTCTC
CAGTGTTAATGATAAACGAGGCTCTGCCAGATGGATAAGTTCAGATGATGAACGTAACATGCGTAATGTT
TATCATGACAGTCAGGATGCCGATATTACAAGAATAAAATATGATATTCAGATTCTTACAGATGAGGAAA
AAGATAATACTACAGACTATGAGTATTTACCCCTGACAAGGATCATATATGGAAATAATTCATTGTGTAT
TGATGATGAGTGTTCATTTCCCGTGATGAGGTTATCTGCGAATCACAAACTTAGAAATAAGATCGCAGAG
ATCTATTCGGATATTAAGTTCTACAAAAATAGACTGGAGAAATACAGATATACAGAACGAACAGTGTCCG
ATGGACATCTTTATAACTTTTTAATTCTATGTGCTATTAATAGGACATTACCACTTCTTTCTTCATTCAT
TAATGAAGATGCCATTCACCCATGGTTGTATTATATGGCATTATGTCAGTTTGCAGGGGAAATATCTACA
TTTCATAACTCTGGACTTTCAGATACTAGGATTGTCGAACTATCATACAATCATTATGAGCAGATCTCAT
GTTTCAGTGATCTGCAGTATTATATTAAGTTAATACTGGATGATTCATGTCGAGATAAGATTATTAGTGT
TGAATTCAGAAAAATAACTACTGATACATTGATCTGTAATTTCGATGAGTACGGTGCCGGAAGTAATTCA
GATTACTATATTAAGTTAACCTCAGATACCTTCAGAAAGAATAAGCTGATTGCATTGCCAGAGATTAAGA
TTGCTCCATCTGAACATATCGACATGATAATTCAGCATGCTCTTCCAGGAATCAAGTTTACAGTGATGGA
TGCCGTTACATCTGATTTGCAGGTAAGAGAGAATACAATCTGGTTAAAGATAGATAAACATTCAGAATTA
TGGACGTTAGCTCAGACTCAAAAAAGAGTTGCATTCTATTGGTCATGTAGTCCTGATGATTTACTTGTAG
AGTTAGTATTATCGCAGGAAAAGTATGCCGTAAGCAGGCCTAAACAGGATAACGGTTCTTTCCATCCGGC
GGTTGGCAGATAA