SecReT6
Protein ID: 387609991
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4575
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4904890..4905480 [+]
Productputative type VI secretion protein
NoteTssL
UniProt IDD3GV02
KEGG IDelo:EC042_4575
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-29, Aligned region: 1..194
Protein Sequence: 196 a.a.     [Download]
>gi|387609991|ref|YP_006098847.1| putative type VI secretion protein [Escherichia coli 042]
MNIVECYMPVFKLISSVRVFPEEYSDYDSTRKNIINTVEEAVRNSEKMSLSDSELDAAFYAVIVMLDEAI
LCSELPCRKEWRDNLLQIKYFGHSTGGVEFFYKLDKVIESGSQAGWVFLLCLLLGFRGKYSVGSNDEINN
YISRLRRQCELNVAIDEGNNISLREKKYKSSRLGFYLLLVGIVAVYFVVLSMIYMR
 
Nucleotide Sequence: 591 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4904890-4905480 Escherichia coli 042, complete genome
GTGAATATTGTTGAATGCTATATGCCAGTATTTAAACTCATATCATCTGTCAGAGTTTTCCCTGAAGAAT
ATAGTGATTACGACAGTACTAGAAAGAATATAATTAACACTGTTGAGGAGGCTGTTCGCAATAGTGAAAA
AATGTCGTTGAGTGACAGCGAACTTGATGCGGCATTTTATGCTGTAATCGTCATGCTTGATGAGGCAATA
TTGTGTTCAGAGCTTCCCTGTAGAAAAGAATGGCGTGATAATCTTTTGCAGATAAAATATTTCGGACACT
CCACTGGGGGGGTCGAGTTCTTTTATAAACTTGATAAAGTCATCGAATCGGGAAGTCAGGCTGGATGGGT
CTTTCTCCTGTGCCTGTTACTGGGTTTCAGAGGTAAATATTCCGTGGGTAGTAATGATGAAATCAATAAT
TATATATCGAGGCTGAGGCGACAATGTGAATTGAATGTTGCAATCGACGAAGGAAACAATATTTCACTCA
GGGAAAAAAAGTATAAATCATCGAGGCTTGGTTTCTATTTATTACTTGTAGGTATTGTTGCTGTCTATTT
TGTGGTTTTATCCATGATTTATATGAGATGA