SecReT6
Protein ID: 387615560
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01085
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]243236..244594 [-]
Producthypothetical protein
NoteTssA
UniProt IDE4P4Z1
KEGG IDeln:NRG857_01085
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 91..156
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 258..271
DUF3702 [PF12486], Evalue: 2.30E-45, Aligned region: 288..434
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 254..261
Protein Sequence: 452 a.a.     [Download]
>gi|387615560|ref|YP_006118582.1| hypothetical protein NRG857_01085 [Escherichia coli O83:H1 str. NRG 857C]
MSNNALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLAR
TRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERA
LQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPL
PDLPEMRVGVRGVADNADKAKQGDTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWL
ASPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQ
ARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c244594-243236 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGAGCAATAACGCACTGACACAAACTATCGTTACCGGAAGCGATCCGCGCGCCCTGCCGGAGTTCAGCG
CCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCACGT
ACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGATGATCATCCACGAAT
GGGATAAATTCTGGCCGCAGAGTGGCCCGGCGCGGACTGAGATGCTGGACTGGTTCAACACCCGCACCGG
GAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACCGCACGGAACGGGCT
TTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAATCTGCTTT
ATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGATACGGCGGCACAGAC
CATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAACCATGCCCCCCCTA
CCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAAAGCAAAACAGGGCG
ACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCACTCTGGTGGTGGCA
GGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCGCCACCGTCTGGTTG
GCCTCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCCGCCACTACAGCCGC
TGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAGC
CAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACAA
GCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAAACAGGGTTTCACCC
TATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACACCACTGGAGTACCT
GCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAAAAGAGATCAACGAA
CGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATATGGCAACGGATAACA
GAACCGAACCTGTCCATCCAACTCATTGA