SecReT6
Protein ID: 387615565
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01110
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]253108..253872 [-]
Producthypothetical protein
NoteTssL
UniProt IDE4P4Z6
KEGG IDeln:NRG857_01110
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.70E-62, Aligned region: 33..237
Protein Sequence: 254 a.a.     [Download]
>gi|387615565|ref|YP_006118587.1| hypothetical protein NRG857_01110 [Escherichia coli O83:H1 str. NRG 857C]
MSDMSEASVFPVEPESGTPGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFAQVVTDVQ
AVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIR
EPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQL
IRRLTIKHVLCGGLVVLTVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 765 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c253872-253108 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGAGCGATATGAGTGAAGCGTCGGTTTTTCCCGTGGAGCCGGAGAGCGGAACACCAGGACGCCAGTACC
GTCTCGCCCTTCGCGGCAACAGCCTGAATCCAATGATTGACGCCGCCACGCCGTTGCTCGGCATGGTGAT
GCGTCTGTCCACTATGAACAGTCAGGCCATGCCGGAACATCTGTTTGCCCAGGTAGTAACCGATGTCCAG
GCCGTAGAGCAACTACTCCAGGAACAGGGATACGAACCGGGCGTCATTGTTTCGTTCCGTTACATTCTCT
GCACGTTTATTGATGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATCAAACAGTCGCT
GCTGGTTCATTTTCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGCCTGATCCGG
GAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGTTTTTCGCTCGGCTTTCGCGGGCGCT
ACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGCCCTGCACAA
ACTGCGCGGTGACGCGCCATTTCCGCTACTTCATCAGAAGAACAACATACAGGGTGGGCGTTATCAGTTA
ATCCGACGACTGACCATCAAGCATGTACTGTGCGGCGGTCTTGTTGTGCTGACCGTATTTTATCTGTTTT
ATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCGATAA