SecReT6
Protein ID: 387615567
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01120
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]255226..255750 [-]
Producthypothetical protein
NoteTssJ
UniProt IDE4P4Z8
KEGG IDeln:NRG857_01120
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|387615567|ref|YP_006118589.1| hypothetical protein NRG857_01120 [Escherichia coli O83:H1 str. NRG 857C]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFHAADYDQVATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIESVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c255750-255226 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTTGTGTTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGATGGCGAAGCCGCTCCGGTGGATGTCCAG
TTGGTTTATCTGAGCGACGACTCAAAATTCCATGCCGCCGACTACGACCAGGTTGCAACCACCGCGCTGC
CCGACGTGCTGGGGAAAAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGATACCGTAAAAACACT
GCCGCCGATCAAGTTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGTCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA