SecReT6
Protein ID: 387615568
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01125
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]255747..257039 [-]
Producthypothetical protein
NoteFha
UniProt IDE4P4Z9
KEGG IDeln:NRG857_01125
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0016, Aligned region: 44..108
Protein Sequence: 430 a.a.     [Download]
>gi|387615568|ref|YP_006118590.1| hypothetical protein NRG857_01125 [Escherichia coli O83:H1 str. NRG 857C]
MEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACAVIR
HDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDS
LADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANG
INTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLS
LQQQQNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVE
ALRVMLDAFSPGNLMRRFAQYRRSHELRQKMDNAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRV
LREKQREPEA
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c257039-255747 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATG
GCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATAC
GCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTGCCGTTATCCGG
CACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCG
ATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCA
TGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGT
CTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTG
CCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGC
AGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTTGCCCCCGCCTCCGATCTGACAGGTGCAAACGGG
ATCAACACGCCGTTTATGGATCTGCCACCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCA
TGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTC
TCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGT
CTGCAACAACAACAGAATAGCCTGTCGGATAAACACCTGCGTCCACTGGAAGACAACCCGTTGCGCCTTG
ATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACC
TGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCCAACCGGGCGGCGATTGTGGAA
GCGTTGCGTGTCATGCTGGACGCCTTCTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCA
GCCATGAGCTGCGCCAGAAAATGGACAACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAACT
GGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTG
CTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA