SecReT6
Protein ID: 387615569
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01130
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]257044..258093 [-]
Producthypothetical protein
NoteTssG
UniProt IDE4P500
KEGG IDeln:NRG857_01130
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-90, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|387615569|ref|YP_006118591.1| hypothetical protein NRG857_01130 [Escherichia coli O83:H1 str. NRG 857C]
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRYGTPGQDISLRTEPAREIVRFSSDASIGFPGTD
LSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRNGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLGDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c258093-257044 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAGCGACAAAACCGCCGTTACCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGTATGGCACGCCGGGCCAGGACATTTCCCT
GCGTACCGAGCCTGCCCGGGAGATCGTGCGTTTCAGCTCTGACGCCAGTATCGGTTTTCCGGGTACGGAC
CTGAGTGCGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGGTTCCTGGGTTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCTGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAACGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTTGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTGGCACCACAGCAGGCTAAAGGGATGCGCCTTGGCGATCCGGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA