SecReT6
Protein ID: 387615570
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01135
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]258057..259898 [-]
Producthypothetical protein
NoteTssF
UniProt IDE4P501
KEGG IDeln:NRG857_01135
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.90E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|387615570|ref|YP_006118592.1| hypothetical protein NRG857_01135 [Escherichia coli O83:H1 str. NRG 857C]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVACHF
TLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEHSLPLPDLWLDAAGFDNQDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
VSAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVS
TVTSKIKVSGTDSSPGSQVRVWPEFESFQHQMEYSRQREVVYWHHRTKTSLFHYGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTQPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQEAWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c259898-258057 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAACTGGATTATCTGCGCCAGCTTGGCAAACTGTTGGCGC
AGGAAAAACCGCATCTGGCCCATTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAATTCACCCATGGG
CTAATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGTCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
CACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGCACAGCCTGCCGCTGCCGGATCTGTGGCTGGATGCTGCGGGTT
TTGACAACCAGGATGCCCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATTTCCCG
GTGAGTGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCAGGATT
CGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCGGATGG
GCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGGTCAGT
ACAGTCACCAGTAAAATCAAAGTGTCAGGGACTGATTCCAGCCCCGGCAGCCAGGTGCGTGTCTGGCCCG
AATTTGAAAGTTTCCAGCACCAGATGGAGTACAGCCGCCAGCGGGAAGTCGTCTACTGGCATCACCGGAC
TAAAACGTCCCTGTTTCACTACGGGCTTGAACATAGTATCGCCTTTGTCCATGCAGACGGTAGCATTCCG
GGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCCC
GGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAATGTCAC
GCGCCCGACACAGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGCG
CTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCG
TTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGGCTTGGGAATGGCAGGAGAAAAT
GGGCCAGCACGCCCTGATATAG