SecReT6
Protein ID: 387615571
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01140
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]259904..260329 [-]
Producthypothetical protein
NoteTssE
UniProt IDE4P502
KEGG IDeln:NRG857_01140
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.90E-21, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|387615571|ref|YP_006118593.1| hypothetical protein NRG857_01140 [Escherichia coli O83:H1 str. NRG 857C]
MQRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELRFHIVATIDVSKTKGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c260329-259904 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGCAAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGCTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCGGCACCGGATGAATACGCCCCTGTGGAACTGCGTTTTCATATTGTGGCTACGAT
CGATGTCAGCAAGACCAAGGGAGTGTTTGAATTTGACATTTTGCTGGACAACCATCAACGCTATTGTGTG
GAGTGA