SecReT6
Protein ID: 387816002
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3620
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3743561..3745666 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH8W8P0
KEGG IDmhc:MARHY3620
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-61, Aligned region: 23..324
Phage_base_V [PF04717], Evalue: 2.00E-25, Aligned region: 364..457
DUF2345 [PF10106], Evalue: 0.0057, Aligned region: 552..609
Protein Sequence: 701 a.a.     [Download]
>gi|387816002|ref|YP_005431497.1| Rhs element Vgr protein [Marinobacter hydrocarbonoclasticus ATCC 49840]
MQFTARVGEFPSDHFVVVGFALTERLSDLFHGRLQLASTDPDVAAADVLEQPVDLVVWQDGQPLRRFTGV
VNEFMRGDTGHRRTRYEVVIQPPLWRLGLMHNSRIFQTQTTDAIVRTLLEERGIVDSIFDFKRPPEEREY
CVQHRETDLQFLERLAAEEGWHYRYQHGSVDGEEQPALILADHHGDAPKLNPVTCNTKAGGSTKQACVFQ
FAYEERVKAASVAMKDYTFKNPAYALMHEQSAGGVNHREDYQHYDYPGRYKADASGQPFTQNKLDALRND
ASMANGKSNRPDFTPGAKVELQDHDSQTLNREWLLTAITHTGKQPQALEEEGGSEPTSYHNTFSAIPADK
TWRPLCNHKPVMDGPQMALVTGPEGEEIHCDQYGRVKVRFPWDRYSKNDEHSSAWLRVAQGWAGGQYGFM
ALPRIGHEVIVSFLDGDPDQPIITGRTYHATNTPPYALPEHKTRTTLKTKTHKGEGSNELRFEDEAGEEQ
VYVHAQKDLDLLTKNNRTEVIRNDSHLTVENNRFSHTKGNSHHTVDGEKREQTGKDHSFNVTGTLHLKAG
TAWLSNSGTELHIKAGQKAVIEAGAEITLKAGGSFVKIDPSGVAMGGASIKMNAGGAAGKGSGQKVQVPE
MPGLVTAAGGAVAPEALAEVSQRANAQPKAIVAHRLKQARMNRTAIVEQCQQKPDGTCPLGNCPCGKNQT
A
 
Nucleotide Sequence: 2106 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3745666-3743561 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
TTGCAGTTCACCGCCCGTGTAGGCGAATTCCCCTCGGACCACTTTGTCGTTGTCGGCTTCGCGCTGACCG
AACGGCTGTCTGATCTGTTCCATGGCCGGTTGCAACTGGCCAGCACCGACCCGGATGTGGCCGCCGCCGA
TGTACTGGAACAACCGGTAGACCTGGTGGTGTGGCAGGACGGCCAGCCCCTGCGCCGGTTCACCGGCGTG
GTGAACGAATTTATGCGGGGTGACACCGGCCACCGCCGCACCCGCTACGAAGTGGTCATCCAGCCGCCCC
TGTGGCGCCTGGGCCTGATGCACAACAGCCGCATCTTCCAGACCCAGACCACCGACGCCATCGTGCGCAC
CCTGCTCGAAGAGCGGGGCATTGTGGATTCCATCTTCGACTTCAAACGCCCACCGGAAGAACGGGAATAC
TGCGTCCAGCACCGGGAAACCGACCTGCAGTTCCTGGAACGCCTGGCCGCCGAAGAAGGCTGGCACTACC
GCTACCAGCACGGCAGCGTGGATGGCGAAGAACAACCGGCACTGATTCTTGCCGACCACCACGGCGACGC
CCCGAAACTGAACCCGGTTACCTGCAACACCAAAGCCGGTGGCAGCACAAAGCAGGCCTGCGTGTTCCAG
TTCGCCTACGAAGAACGGGTCAAAGCCGCCTCCGTGGCCATGAAAGACTACACCTTCAAGAACCCCGCCT
ACGCCCTGATGCACGAACAAAGTGCCGGCGGTGTTAACCACCGGGAAGACTACCAGCACTACGACTACCC
CGGCCGTTACAAAGCCGACGCCAGCGGCCAGCCGTTCACCCAGAACAAACTGGATGCGCTTAGAAACGAC
GCATCCATGGCCAACGGCAAAAGCAACCGCCCGGATTTCACCCCCGGCGCCAAAGTGGAACTGCAGGACC
ACGACAGCCAGACCCTGAACCGGGAATGGCTGCTCACCGCTATTACCCACACCGGCAAACAGCCCCAGGC
CCTGGAAGAAGAGGGTGGCAGTGAGCCCACCAGCTACCACAACACCTTCAGCGCCATCCCGGCCGACAAA
ACCTGGCGCCCGCTGTGCAACCACAAACCCGTGATGGACGGCCCCCAGATGGCCCTCGTCACCGGCCCGG
AGGGGGAAGAAATCCACTGCGACCAGTACGGCCGGGTAAAAGTAAGATTCCCTTGGGACCGCTATTCCAA
GAACGACGAACACTCAAGCGCCTGGCTGCGCGTGGCCCAGGGCTGGGCCGGCGGCCAGTACGGCTTCATG
GCCTTGCCCAGAATCGGCCATGAAGTGATTGTCTCCTTCCTGGACGGCGACCCGGACCAGCCCATCATCA
CCGGAAGAACCTACCACGCCACCAACACACCGCCGTACGCGCTGCCGGAACACAAAACCCGGACCACCCT
GAAGACCAAAACCCACAAGGGGGAGGGCAGCAACGAACTGCGGTTTGAAGATGAAGCCGGCGAAGAACAG
GTCTACGTGCACGCCCAGAAAGACCTGGACCTGCTGACGAAAAACAACCGTACCGAAGTCATCAGGAACG
ACAGCCACCTGACGGTGGAAAACAACCGCTTCAGCCACACCAAAGGCAACAGCCATCACACCGTGGACGG
CGAAAAGCGCGAGCAAACCGGCAAAGACCACAGCTTCAATGTCACCGGTACTCTGCACCTGAAAGCCGGC
ACCGCCTGGCTCAGCAATTCCGGCACCGAACTGCACATCAAAGCCGGCCAGAAAGCCGTGATCGAAGCCG
GCGCTGAGATCACCCTGAAAGCCGGCGGCAGCTTCGTAAAGATCGATCCCAGTGGCGTGGCCATGGGGGG
CGCGAGTATCAAGATGAATGCCGGTGGGGCTGCAGGTAAAGGCAGTGGGCAGAAGGTGCAGGTGCCGGAG
ATGCCGGGGTTGGTGACGGCTGCTGGCGGGGCAGTGGCGCCGGAGGCGTTGGCGGAGGTTAGCCAGAGAG
CGAATGCTCAGCCAAAAGCCATCGTTGCCCACCGACTGAAACAGGCTCGGATGAATCGAACGGCTATTGT
TGAGCAGTGCCAGCAGAAACCCGATGGCACTTGTCCGCTTGGGAACTGTCCTTGCGGTAAGAATCAGACA
GCGTGA