SecReT6
Protein ID: 387816004
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3622
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3749409..3750857 [-]
Producthypothetical protein
NoteTssA
UniProt IDH8W8P2
KEGG IDmhc:MARHY3622
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-17, Aligned region: 52..112
PGC7_Stella [PF15549], Evalue: 0.0013, Aligned region: 185..240
PGC7_Stella [PF15549], Evalue: 0.0013, Aligned region: 416..441
Protein Sequence: 482 a.a.     [Download]
>gi|387816004|ref|YP_005431499.1| hypothetical protein MARHY3622 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MQVIEQHPYVDQVLNAIPGDTGVGESLAEDSTLEFLEDEIMKVGSLAHNDIDWHKVESEALKLLADRSKD
IKVLGFVMLSLQRGGDGERFALSLYLLHRVLDDWWENAWPYPGAKGQRARKMLFTQMLQRALKAVESLNF
DASVGDGRQFCLDLVEKLDTQAKDRDLPDDALFDLKRAVEKLPKPDQATAPRTASESSPTNKQESTASSS
PSSSASSNTTAASLGNLTLDPSNERATRQSLLKVAELLTSSEPDNALGYRMRRYAIWQSITSLPPTRDGK
RTDLAAVSADRVAEYREALEKTPDLELWQRIEQSLSVSPFWLDGHWLSARAAMALGNTDCAEAIREALKA
FVDRLPQLAELTFNDGTPFLSDDGADWLHTAPAAGKGTGAGANPWEQAFDGALELVRQNKLAPAMELLEQ
GLADAREPRERFYWRLATARLLKETGLKALAAEQIQDLKNQIQGRVLEDWEPALVKQLERLA
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3750857-3749409 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGCAGGTGATTGAACAGCATCCTTACGTGGATCAGGTACTGAACGCGATTCCGGGAGACACCGGGGTAG
GCGAAAGCCTGGCTGAAGACAGCACGCTGGAGTTTCTCGAAGACGAGATCATGAAAGTGGGCTCGCTGGC
CCACAACGACATCGACTGGCACAAGGTTGAAAGTGAAGCACTGAAACTGCTGGCGGATCGCAGCAAGGAC
ATCAAGGTGCTGGGTTTTGTCATGCTCAGCCTGCAACGCGGCGGCGATGGTGAACGGTTTGCCCTGTCGC
TGTACCTGCTGCATCGGGTGCTGGACGACTGGTGGGAGAACGCCTGGCCCTATCCCGGTGCCAAGGGGCA
GCGGGCCCGCAAGATGCTGTTTACCCAGATGCTGCAGCGGGCCCTTAAAGCGGTTGAGAGCCTGAACTTT
GATGCCAGCGTAGGAGATGGTCGTCAGTTCTGTCTGGACCTGGTTGAGAAACTGGACACCCAGGCGAAAG
ACCGGGATTTGCCTGACGACGCCCTGTTCGACCTGAAGCGGGCCGTGGAAAAGTTGCCCAAGCCGGACCA
GGCCACCGCGCCCCGGACGGCGTCTGAAAGCTCCCCGACAAACAAACAGGAGAGCACGGCCAGCTCATCG
CCCTCCAGCTCGGCCAGTTCCAACACTACGGCCGCGTCGCTGGGCAATCTGACACTGGACCCGAGTAATG
AGCGTGCGACCCGGCAGAGTCTGCTCAAGGTCGCCGAGCTGCTGACCAGCAGCGAACCGGACAACGCCCT
GGGCTACCGGATGCGTCGGTATGCCATCTGGCAGAGTATCACCAGCCTGCCGCCAACCCGGGATGGCAAG
CGCACAGATCTGGCAGCCGTCAGCGCAGACCGGGTGGCCGAGTACAGGGAAGCTCTGGAGAAAACACCGG
ACCTGGAACTTTGGCAGCGCATTGAACAAAGCCTGTCGGTCAGCCCGTTCTGGCTCGATGGCCACTGGCT
CAGCGCCCGGGCGGCCATGGCCCTTGGCAATACCGATTGCGCGGAGGCCATCCGGGAAGCCCTGAAAGCG
TTTGTCGACCGCCTGCCGCAACTGGCCGAGCTCACCTTCAACGATGGCACACCGTTTCTCAGTGACGATG
GTGCAGATTGGTTGCACACAGCCCCGGCAGCTGGCAAAGGAACGGGCGCAGGTGCCAATCCCTGGGAGCA
GGCATTCGACGGTGCGCTTGAGCTGGTGCGGCAGAACAAACTGGCGCCGGCCATGGAACTGCTGGAACAG
GGTCTGGCCGATGCCCGGGAGCCGCGCGAGCGCTTCTACTGGCGCCTGGCTACGGCCCGGCTACTCAAGG
AAACCGGCCTGAAAGCCCTGGCCGCCGAACAGATTCAGGATCTGAAAAACCAGATCCAGGGGCGGGTTCT
CGAAGACTGGGAACCGGCTCTTGTAAAACAACTGGAACGACTGGCGTAA