SecReT6
Protein ID: 387816007
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3625
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3753406..3756093 [-]
ProductClpA/B-type chaperone (evpH-like)
NoteTssH
UniProt IDH8W8P5
KEGG IDmhc:MARHY3625
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 234..312
AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 633..794
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 236..366
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 639..761
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 236..277
AAA_5 [PF07728], Evalue: 1.90E-14, Aligned region: 638..760
ClpB_D2-small [PF10431], Evalue: 2.60E-14, Aligned region: 150..170
ClpB_D2-small [PF10431], Evalue: 2.60E-14, Aligned region: 800..874
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 94..141
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 213..253
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 279..314
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 609..677
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 703..732
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 823..844
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 235..328
AAA_22 [PF13401], Evalue: 2.80E-08, Aligned region: 637..728
AAA_25 [PF13481], Evalue: 1.80E-05, Aligned region: 236..276
AAA_25 [PF13481], Evalue: 1.80E-05, Aligned region: 633..670
AAA_25 [PF13481], Evalue: 1.80E-05, Aligned region: 798..847
AAA_19 [PF13245], Evalue: 2.10E-05, Aligned region: 233..257
AAA_19 [PF13245], Evalue: 2.10E-05, Aligned region: 379..413
AAA_19 [PF13245], Evalue: 2.10E-05, Aligned region: 633..660
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 228..252
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 635..663
NACHT [PF05729], Evalue: 0.00037, Aligned region: 44..71
NACHT [PF05729], Evalue: 0.00037, Aligned region: 236..263
NACHT [PF05729], Evalue: 0.00037, Aligned region: 397..455
NACHT [PF05729], Evalue: 0.00037, Aligned region: 639..666
NACHT [PF05729], Evalue: 0.00037, Aligned region: 844..866
AAA_14 [PF13173], Evalue: 0.00079, Aligned region: 304..417
AAA_14 [PF13173], Evalue: 0.00079, Aligned region: 637..720
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 216..250
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 288..320
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 639..674
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 709..725
DUF258 [PF03193], Evalue: 0.001, Aligned region: 213..253
DUF258 [PF03193], Evalue: 0.001, Aligned region: 639..679
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 236..256
AAA_18 [PF13238], Evalue: 0.0017, Aligned region: 639..675
Clp_N [PF02861], Evalue: 0.002, Aligned region: 43..83
Clp_N [PF02861], Evalue: 0.002, Aligned region: 121..141
Sigma54_activat [PF00158], Evalue: 0.0042, Aligned region: 234..252
Sigma54_activat [PF00158], Evalue: 0.0042, Aligned region: 637..736
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 220..260
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 638..649
AAA_17 [PF13207], Evalue: 0.0098, Aligned region: 236..277
AAA_17 [PF13207], Evalue: 0.0098, Aligned region: 529..553
AAA_17 [PF13207], Evalue: 0.0098, Aligned region: 639..673
Protein Sequence: 895 a.a.     [Download]
>gi|387816007|ref|YP_005431502.1| ClpA/B-type chaperone (evpH-like) [Marinobacter hydrocarbonoclasticus ATCC 49840]
MCSAFWNNYRNKDIIVIRVELPALIGRLNDISRQALEASAALCISRQGAEITPAHLLFKLLETPFSDVRQ
ILEHTGINHQQLQPVVGDSLNGEPQTAEPYPSFSPLLVELMQDAWLLASTELGHTELRSGAVFLALLMNA
DRYLMPRVAQALVDINREQLRKQFDRVTEGSVERPQLTESGGARPAVESDMDPLKRYATDFTKLAREDKL
DPVVCRDAEIDQMIDILCRRRKNNPIVVGDAGVGKSAVVEGLALRIVNGDVPDRLKNVELWTLDMGALQA
GASVKGEFEKRLKGVIEAVKGSATPIILFIDEAHTLIGAGNSEGGSDAANLLKPALARGELRTIAATTWR
EYKKYFEKDPALSRRFQPVALDEPTPGEAVHILRGLRTVYEKAHQVLIADSALKAAAEMSARYLAGRQLP
DKAIDVLDTACARVSLNLSTPPRRLSHVRSELHQLAMEQELLSREHTLGQNVDAEREQALEQKIADLTAE
SGALEQSWNDQRELVARLVEIREQLLVGDVERETADDVAVELAESDHEERPDLKSEAAAIEQELAELQAD
EPLVHARVDARQVAEVIADWTGIPVNRMTTDELEKITHLPAYLQAHIKGQDTAIDCLHQHLLTARADLRR
PGRPMGAFLLVGPSGVGKTETVVQLAELLYGGRQFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGILT
EAIRQKPYSVVLLDEVEKAHPEVLNLFYQAFDKGELADGEGRLIDCKNVVFFLTSNLGFQTIVNHAEEPE
KIEEALYPELANFFKPALLARMEVVPYLPLGEDTLNRIVEDKLQRLADQIQARYHTEVELEDGLVEAIRS
RATRSENGARMLESIIEGELLPPVSLALLEKLAAREPVTKVKLGVEENRFTGTVA
 
Nucleotide Sequence: 2688 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3756093-3753406 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGTGCTCAGCGTTCTGGAACAACTACCGAAATAAGGACATCATTGTGATTCGGGTAGAACTGCCGGCGC
TGATCGGGCGCCTTAACGACATTTCACGCCAGGCTCTGGAAGCCTCCGCGGCCCTGTGCATCAGCCGTCA
GGGCGCCGAGATTACCCCGGCGCACCTGCTGTTCAAACTGCTGGAAACGCCGTTCTCGGATGTGCGCCAG
ATTCTGGAACACACCGGCATCAACCACCAGCAACTGCAACCCGTGGTGGGTGACAGCCTGAACGGCGAAC
CTCAGACCGCCGAACCGTATCCGTCGTTCTCGCCGCTGCTGGTAGAACTGATGCAGGACGCCTGGCTGCT
GGCCTCCACCGAACTCGGCCATACCGAACTGCGTTCCGGCGCGGTGTTCCTGGCCCTGCTGATGAACGCC
GATCGCTACTTGATGCCCCGGGTGGCGCAGGCGCTGGTGGACATCAACCGGGAACAGCTGCGCAAGCAGT
TTGATCGGGTAACCGAGGGTTCTGTGGAGCGTCCGCAGCTGACGGAAAGCGGTGGTGCCAGGCCAGCGGT
TGAATCCGATATGGACCCGCTCAAACGTTATGCCACTGACTTCACCAAGCTGGCCCGGGAAGACAAACTG
GACCCCGTGGTGTGTCGCGATGCCGAGATCGATCAGATGATCGATATCCTATGCCGTCGCCGCAAGAACA
ACCCCATCGTGGTGGGCGACGCTGGCGTGGGCAAAAGCGCCGTGGTGGAGGGCCTGGCCCTGCGCATCGT
CAACGGCGACGTGCCGGACCGCCTGAAGAACGTCGAACTCTGGACCCTGGACATGGGTGCCCTGCAGGCC
GGTGCCTCGGTGAAGGGCGAGTTTGAAAAACGCCTGAAGGGCGTGATCGAAGCCGTGAAAGGTTCGGCGA
CCCCGATCATCCTGTTCATCGACGAAGCTCACACCCTGATCGGTGCGGGTAACAGCGAAGGTGGCTCCGA
CGCTGCCAACCTGCTGAAGCCAGCCCTGGCCCGTGGCGAACTGCGCACCATTGCTGCCACCACCTGGCGC
GAGTACAAGAAATACTTCGAAAAAGACCCGGCTCTCAGCCGCCGGTTCCAACCGGTGGCCCTGGACGAGC
CAACGCCGGGCGAAGCAGTCCACATCCTCCGTGGCCTGCGCACGGTCTACGAAAAAGCCCATCAGGTACT
GATCGCCGACAGCGCCCTTAAAGCCGCCGCAGAAATGTCCGCCCGTTACCTGGCCGGTCGCCAGCTGCCG
GACAAGGCCATCGATGTTCTCGATACCGCCTGCGCCCGGGTCAGCCTGAACCTGAGTACACCGCCACGCC
GTCTCAGTCATGTGCGCAGTGAACTGCACCAACTGGCCATGGAACAGGAGCTTCTGAGCCGGGAACACAC
GCTTGGCCAGAACGTGGATGCCGAGCGCGAACAGGCCCTGGAGCAGAAGATTGCTGACCTGACCGCCGAA
TCCGGAGCGCTGGAACAAAGCTGGAATGACCAGAGGGAGCTTGTTGCCCGGCTGGTCGAGATCCGTGAAC
AGCTGTTGGTGGGGGATGTCGAGCGCGAAACCGCCGATGATGTTGCTGTTGAGTTGGCCGAGAGCGATCA
CGAAGAACGCCCGGACCTGAAAAGCGAAGCCGCCGCCATCGAACAGGAACTGGCTGAACTCCAGGCCGAC
GAACCGTTGGTACACGCCCGGGTGGACGCCCGCCAGGTAGCCGAAGTCATCGCTGACTGGACCGGCATCC
CGGTCAACCGCATGACCACCGACGAGCTGGAAAAAATCACCCACCTGCCGGCGTACCTGCAGGCCCATAT
CAAAGGCCAGGACACGGCCATCGACTGCCTGCACCAGCACCTGCTCACCGCCCGCGCCGACTTGCGCCGG
CCGGGTCGCCCCATGGGCGCCTTCCTGCTGGTGGGCCCCAGTGGTGTGGGTAAAACCGAAACCGTGGTAC
AACTGGCTGAACTGCTCTACGGCGGCCGCCAGTTCCTCACCACCATCAACATGTCCGAATATCAGGAGAA
ACACACTGTCTCCCGTCTGATCGGCTCGCCCCCAGGCTACGTCGGATTCGGAGAAGGGGGCATCCTCACC
GAAGCCATCCGCCAGAAGCCTTATTCCGTGGTGCTGCTCGACGAAGTCGAAAAAGCCCACCCGGAAGTGC
TTAACCTTTTCTACCAGGCTTTCGACAAAGGCGAACTGGCTGACGGAGAAGGCCGGTTGATCGACTGCAA
AAACGTGGTCTTTTTCCTGACCTCCAACCTCGGCTTCCAGACCATCGTCAACCACGCCGAAGAGCCGGAG
AAAATCGAAGAAGCCCTGTACCCGGAACTGGCCAACTTCTTCAAGCCGGCATTGCTGGCGCGGATGGAAG
TGGTGCCCTACCTGCCGCTGGGTGAAGACACTCTCAACCGCATCGTTGAGGACAAACTCCAGCGCCTGGC
GGATCAGATTCAAGCTCGCTACCACACCGAGGTGGAACTGGAAGACGGCCTGGTCGAAGCCATCCGCAGC
CGCGCCACCAGAAGTGAAAACGGCGCGCGGATGCTGGAGTCGATCATCGAAGGCGAACTGCTGCCACCGG
TGTCGCTGGCGTTGCTGGAAAAACTGGCGGCCAGGGAGCCGGTGACGAAGGTGAAACTGGGTGTGGAAGA
AAACAGATTTACAGGAACCGTCGCTTAG