SecReT6
Protein ID: 387816008
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3626
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3756059..3756880 [-]
Producthypothetical protein
NoteTssL
UniProt IDH8W8P6
KEGG IDmhc:MARHY3626
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-72, Aligned region: 51..257
Protein Sequence: 273 a.a.     [Download]
>gi|387816008|ref|YP_005431503.1| hypothetical protein MARHY3626 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MADAPVMDRPDNTRDSGDRAFSDLLFADSGAGQSPVESDDSSFQLRGLEDNRLIDAATPLLGLVIRVRRL
ADFREVETLYRQVVDEVAAVDRELVEQGYERPTVVAYRYVLCAFIDEAVLGTDWGAHSVWSQHSLLSRFH
NETWGGEKVFAILARMEKEPTRYRDMLEFIYLCLCLGFEGRYKVMENGRDEYEQVVRGLYDQLRELRGDR
DSRPLADATENLMPARNRLRSGLPLWGIGGLFVAAMAGIYSLYNMALNERIRDVLSVLEQLPK
 
Nucleotide Sequence: 822 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3756880-3756059 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGGCAGATGCACCGGTAATGGACAGACCAGACAACACCAGGGATTCAGGTGATCGTGCATTCAGCGACC
TTTTGTTTGCCGATAGCGGCGCCGGCCAGTCGCCGGTTGAATCCGATGACAGCAGCTTCCAGCTTCGTGG
CCTGGAAGATAACCGGCTGATTGACGCCGCCACCCCGCTGCTGGGACTGGTTATTCGGGTGCGGCGACTG
GCGGATTTCCGCGAGGTGGAAACTCTGTACCGGCAGGTAGTGGACGAAGTCGCCGCCGTTGACCGGGAAC
TGGTGGAGCAGGGCTATGAGCGCCCCACGGTGGTGGCCTACCGCTACGTGCTTTGCGCCTTCATCGACGA
GGCTGTGCTGGGCACCGACTGGGGCGCCCACAGCGTCTGGTCTCAGCATTCGCTGCTCAGCCGATTCCAT
AACGAAACCTGGGGTGGCGAAAAGGTGTTTGCCATCCTGGCCCGCATGGAAAAAGAGCCGACTCGTTACC
GGGACATGCTCGAGTTCATCTATCTGTGCCTGTGTCTGGGTTTTGAGGGTCGCTACAAGGTCATGGAAAA
CGGTCGGGACGAATACGAACAGGTGGTTCGTGGCCTCTATGACCAGCTTCGCGAACTGCGTGGCGACCGC
GACAGCCGGCCGCTGGCCGATGCCACGGAAAACCTGATGCCGGCCCGCAACCGCCTGCGCAGCGGCCTGC
CCTTGTGGGGTATTGGAGGCCTGTTCGTGGCGGCCATGGCCGGGATCTATTCGCTCTATAACATGGCGCT
GAACGAACGCATCAGGGATGTGCTCAGCGTTCTGGAACAACTACCGAAATAA