SecReT6
Protein ID: 387816009
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3627
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3756884..3758218 [-]
Producthypothetical protein
NoteTssK
UniProt IDH8W8P7
KEGG IDmhc:MARHY3627
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-165, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|387816009|ref|YP_005431504.1| hypothetical protein MARHY3627 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MAVTNRVVWSDGLFIKPQHFQQQQRYLEHQINERALAVSDYLFGFSDLELNAEYLSFGRVGLVRASGLFP
DGTRFNLPQDDVMPEPLEITDASVANQVVYLALPLGSDSLAEVEWPEAPVAGRFQAQPVEVRDLHSIDGD
AHTIDVGRVAPRLMLEREDRSAYAALAIGRILEKRPDGSLVMDPNFLPTMLSVRSAPRLQRFVGEMAGLM
QERARNIAERVGAPGQGGVADVSDFMLLQMLNRAHPRFMHLARLRQLHPERLYEALLELCGELVTFTDES
RLPREFTPYDHDLPEGCFSPLMQILRQALSTVLEPRALSIALQQRQYGLTVAPVQDGQLMNDAEFILAVK
ADMPLDDLRKQFVQQCKVASVEKIRDLISLQLPGIPLSALPVAPRQLPYHAGFVYFRLDDQSQAWQMLDN
ASGFAFHVAGSFPGLEMQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3758218-3756884 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGGCAGTCACGAATCGAGTGGTCTGGAGTGATGGGTTGTTCATCAAACCCCAGCACTTCCAGCAACAGC
AACGCTATCTGGAACACCAGATCAACGAACGGGCTCTGGCCGTCTCGGACTATCTGTTCGGGTTCAGTGA
TCTGGAGCTCAATGCCGAATACCTGAGCTTTGGTCGGGTCGGACTGGTGCGGGCCTCTGGACTGTTTCCG
GACGGAACCCGGTTCAACCTGCCCCAGGACGATGTGATGCCGGAGCCGCTGGAGATCACCGATGCCTCGG
TGGCCAACCAGGTGGTCTATCTGGCTTTACCTCTGGGCAGCGATAGCCTGGCCGAAGTCGAATGGCCGGA
AGCACCCGTGGCCGGCCGGTTCCAGGCGCAGCCGGTGGAAGTGCGGGATCTGCATTCCATTGACGGCGAT
GCTCACACCATCGATGTGGGGCGGGTGGCTCCGCGCCTGATGCTGGAGCGGGAAGACCGCAGTGCCTATG
CAGCACTGGCCATTGGCCGGATTCTGGAAAAGCGCCCCGATGGCAGCCTGGTAATGGACCCGAACTTCCT
GCCGACCATGCTCAGCGTGCGCTCGGCGCCAAGGCTTCAGCGCTTTGTCGGTGAGATGGCGGGTTTGATG
CAGGAACGGGCCCGTAACATTGCCGAACGGGTGGGCGCGCCCGGGCAGGGTGGTGTCGCCGATGTCTCGG
ATTTCATGCTGCTGCAAATGCTGAACCGGGCGCATCCGCGTTTCATGCACCTGGCACGGCTGCGTCAGCT
GCACCCGGAGCGTCTGTACGAAGCGCTTCTGGAGCTGTGTGGCGAGCTGGTCACCTTTACCGATGAAAGC
CGTTTGCCGAGGGAATTCACCCCTTACGATCACGATCTGCCGGAAGGCTGTTTCAGCCCGCTGATGCAGA
TTCTGCGGCAGGCGTTGAGCACGGTCCTGGAACCCCGGGCGCTGTCGATTGCCCTGCAGCAGCGCCAGTA
TGGACTCACCGTCGCACCGGTTCAGGATGGCCAGTTGATGAACGACGCCGAGTTCATTCTGGCGGTCAAA
GCCGATATGCCACTGGACGACCTGCGCAAACAGTTTGTTCAACAGTGCAAGGTGGCCTCTGTGGAGAAGA
TTCGGGATCTCATCAGCCTCCAGCTGCCGGGCATCCCACTGTCGGCACTTCCGGTGGCCCCGCGTCAGTT
GCCCTACCACGCCGGCTTTGTGTATTTCCGATTGGACGATCAAAGCCAGGCCTGGCAGATGCTGGACAAC
GCCAGTGGATTTGCCTTCCACGTGGCGGGCAGCTTCCCGGGGCTGGAGATGCAATTCTGGGCAATCAGGA
GCTAA