SecReT6
Protein ID: 387816010
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3628
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3758218..3758751 [-]
Producthypothetical protein
NoteTssJ
UniProt IDH8W8P8
KEGG IDmhc:MARHY3628
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-35, Aligned region: 12..169
Protein Sequence: 177 a.a.     [Download]
>gi|387816010|ref|YP_005431505.1| hypothetical protein MARHY3628 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MKYCKWSLLVVALILAGCSTPYNAVTKTAKVLWDPDIPVGYPEDLPSRVDLTMLAEPNVNPNESLAPTPI
AFQVIELRDSSLLMAGDFDQLLNDLEDSLGQNYVDHSDYSLVPGQFKFVEPFEVSTDTRYIAVIAFYAYP
NLSQWKKVVKVDPIGGRYHLLVNLREREVQLRRSDES
 
Nucleotide Sequence: 534 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3758751-3758218 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
GTGAAGTACTGCAAATGGAGCTTGCTGGTTGTTGCTTTGATTCTCGCGGGGTGTAGCACCCCTTACAACG
CGGTGACCAAGACCGCCAAGGTGCTCTGGGATCCTGATATTCCTGTTGGCTACCCGGAAGATTTGCCCAG
CCGGGTGGATCTCACCATGCTGGCGGAACCGAACGTGAACCCGAATGAATCCCTGGCACCCACCCCCATT
GCGTTTCAGGTGATTGAACTGCGGGACAGCTCGCTGCTGATGGCCGGCGATTTCGACCAGCTGTTGAACG
ACCTGGAGGACTCTCTGGGCCAGAACTACGTGGACCATAGCGATTACAGCCTCGTGCCCGGCCAGTTCAA
ATTTGTCGAGCCCTTTGAGGTCAGCACCGACACCCGCTACATCGCCGTGATCGCCTTCTACGCCTACCCG
AACCTGTCCCAGTGGAAAAAAGTGGTGAAGGTCGACCCGATTGGCGGACGGTATCACCTGCTGGTGAACC
TGCGCGAACGTGAAGTGCAACTCAGACGGTCGGATGAAAGCTAA