SecReT6
Protein ID: 387816011
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3629
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3758748..3760058 [-]
Producthypothetical protein
NoteFha
UniProt IDH8W8P9
KEGG IDmhc:MARHY3629
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-06, Aligned region: 35..101
FHA [PF00498], Evalue: 1.20E-06, Aligned region: 236..243
Protein Sequence: 436 a.a.     [Download]
>gi|387816011|ref|YP_005431506.1| hypothetical protein MARHY3629 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MAQQAAELTLVITNPTEIGGGASIEHSFGTRGGSIGTAASDSWQLSPHRTGAVAGHAEVRYLDGGFCLID
RSGRTYINSSSQPVGRGRRARLSHGDTVTIGRYQIRAELSGVPAAVGETDHDAREDHGLVDAPENGLRHA
ANEQNRPEGREPLEGLQPAAGDPVSCDPLAPWQQKPTRPDEEAPELLASDQAWFARSAEVSDEYRENRDV
AMGLPVTPQREHKERQGMSETTRNMREVSRQHISGAPLLRGLDADIDFADSDEMRLFLEEAGQTLKATVE
GLLALHQGEDSRHQALRTRLQPIEDNPLRLANDYSDTIQTLFAAQRSPVHLSAPAAVRESLESLNHHQQA
TREAIREALEAILHAFSPEALLRRFHGYRRGLQDNEDEGRWAWDMYQHYYRELKSSRQQGFERLFQEVFD
QAYDQHLRQLQREKLL
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3760058-3758748 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
GTGGCACAACAAGCAGCAGAACTGACATTAGTGATCACCAACCCGACGGAAATCGGTGGTGGCGCCAGCA
TTGAACATAGCTTCGGAACCCGTGGCGGTTCCATCGGCACCGCGGCCAGCGACAGCTGGCAGCTTTCGCC
TCACCGTACCGGCGCTGTCGCCGGCCATGCCGAGGTGCGTTACCTGGACGGTGGCTTCTGCCTGATTGAT
CGCAGTGGCCGGACCTACATCAACAGCAGCAGTCAGCCTGTGGGGCGGGGCCGTCGTGCCCGACTGAGCC
ACGGCGACACCGTGACCATAGGCCGCTACCAGATACGGGCCGAACTCTCCGGCGTCCCGGCGGCTGTCGG
TGAAACCGACCACGACGCACGCGAAGATCATGGTCTGGTGGATGCGCCAGAGAATGGTTTACGGCATGCC
GCTAACGAACAGAACCGGCCTGAAGGTCGCGAGCCTCTGGAGGGTTTGCAGCCGGCAGCCGGCGATCCGG
TCAGCTGTGATCCGCTGGCGCCCTGGCAGCAAAAACCGACGCGCCCGGACGAGGAGGCTCCCGAGCTGCT
GGCCAGCGACCAAGCCTGGTTTGCCCGTTCGGCTGAGGTTAGCGATGAGTACCGGGAGAACCGGGATGTG
GCCATGGGTCTGCCGGTCACCCCACAACGCGAGCATAAGGAACGACAGGGAATGTCCGAAACGACACGAA
ACATGCGGGAGGTCAGCCGCCAGCACATCAGTGGTGCACCACTGCTCCGGGGGCTGGATGCGGATATTGA
TTTTGCCGACAGCGACGAAATGCGGCTGTTTCTGGAGGAAGCCGGCCAGACCCTGAAGGCAACGGTGGAA
GGATTACTGGCGCTGCATCAGGGCGAAGACAGCCGTCACCAGGCGCTGCGCACCCGCTTGCAGCCCATCG
AGGACAACCCGCTGCGGCTGGCCAACGACTATTCGGACACCATTCAGACTCTGTTTGCCGCCCAGCGCAG
CCCGGTGCATCTGTCGGCCCCCGCCGCTGTCCGTGAGAGTCTGGAAAGCCTGAATCACCACCAGCAGGCC
ACCCGGGAAGCCATTCGCGAGGCGCTGGAAGCCATTCTGCACGCCTTCTCGCCGGAAGCCCTGTTGCGCC
GGTTTCACGGCTATCGCCGTGGTTTGCAGGACAACGAAGACGAGGGCCGCTGGGCCTGGGATATGTACCA
ACACTATTACCGTGAACTGAAATCCAGTCGTCAGCAGGGTTTTGAACGCCTGTTCCAGGAAGTGTTCGAC
CAGGCTTATGACCAACACTTGCGCCAATTACAGAGGGAGAAACTGTTGTGA