SecReT6
Protein ID: 387816013
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3631
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3761056..3762828 [-]
Producthypothetical protein
NoteTssF
UniProt IDH8W8Q1
KEGG IDmhc:MARHY3631
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.20E-210, Aligned region: 3..590
Protein Sequence: 590 a.a.     [Download]
>gi|387816013|ref|YP_005431508.1| hypothetical protein MARHY3631 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MKLNRFYRDELSFLRLQGREFAEAHPQLTRFLSEQSTDPDVERLLEGFAFLTGKLREKVEDEFPELTHSL
LNMLWPNYLRPVPSCTIMRFDPQLHAISERQVVDRHTEIKSRPLGDASRQTQCRFRTCRAVDIFPISVAE
ANAEHSREVSSVTVDLALHTDQPLNGIGLENLRFYLGGDNHTAETLYLWLNHYLSRMELVVGDRVFSLPS
SLLQPVGFAADEAILPYPKNAYAGYRIIQEYLSFPEAFRFVDITGLKSRLPAVQADEISLRFHFSRILPP
DTRVTRDSMQLYCTPAVNLFSHEGEPVDLNGRQTEYRISPSSRCPEHYEVFSIEQVEGWLEGRSGRGEPR
IYTAFESFQHEVERDRGRTALYYRVRTRESVRGDGFDHYISFVRGDETECLNRQEAVSLTLTCTNRQLPQ
QLAVGEVCMATESTPAFAAFSNITRPTATLRPTLDGSLLWTLISNLSLNYLSMLDVDALRTVLRVYDFRA
LVDRQAERVSQKRLAGITGITTKPVDRMIRGLPVRGIRSELKLDQHGFASEGDLYLFGTVLSQFFALYAS
INAFHQLEVVNTDNQERYTWTLQQGQQPLM
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3762828-3761056 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGAAGTTAAACAGGTTCTACAGGGATGAGTTGAGCTTTCTGCGGTTGCAAGGCAGGGAATTTGCCGAAG
CCCACCCGCAGCTCACCCGCTTTCTATCCGAACAGAGCACCGACCCGGACGTAGAACGGCTGCTGGAAGG
CTTCGCCTTCCTGACCGGCAAACTGCGGGAAAAAGTTGAGGACGAGTTTCCGGAGCTGACTCATTCGCTG
CTGAACATGCTCTGGCCCAATTATCTGCGGCCAGTGCCCAGCTGCACCATCATGCGCTTTGATCCACAAC
TGCATGCCATCAGTGAACGTCAGGTTGTTGATCGTCATACCGAGATCAAGAGCCGCCCCCTGGGCGACGC
CAGCCGCCAGACCCAATGCCGGTTCCGCACCTGCCGGGCGGTGGATATTTTTCCGATCAGTGTGGCCGAG
GCCAATGCCGAGCACTCACGGGAAGTTTCCTCTGTGACCGTAGACCTGGCGCTGCATACGGACCAGCCAC
TGAATGGCATTGGCCTGGAAAATCTGCGCTTTTACCTGGGGGGCGACAACCACACGGCAGAGACTCTGTA
TCTGTGGCTGAACCATTACCTCAGCCGTATGGAACTGGTGGTGGGCGACCGTGTGTTCAGCCTGCCTTCA
TCCCTGTTGCAGCCGGTTGGCTTTGCGGCAGACGAGGCGATCCTGCCTTACCCCAAGAATGCTTATGCCG
GCTACCGGATTATCCAGGAGTACCTGAGTTTTCCGGAGGCCTTCCGGTTTGTTGATATCACCGGCCTGAA
ATCCCGATTGCCAGCGGTGCAGGCTGATGAGATCAGTCTGCGTTTCCACTTCAGCCGCATTTTGCCCCCG
GACACCCGGGTAACCCGCGACTCCATGCAGTTGTACTGCACCCCCGCGGTAAATCTGTTCAGCCACGAAG
GCGAGCCCGTAGACCTGAACGGTCGCCAGACTGAATACCGTATTTCACCCTCCAGCCGCTGCCCGGAACA
CTACGAGGTGTTCAGTATCGAGCAGGTTGAGGGCTGGCTTGAAGGCCGTTCCGGCCGGGGTGAACCGCGC
ATTTACACGGCGTTCGAGAGTTTCCAGCATGAAGTGGAGCGGGATCGCGGCCGCACCGCCCTGTATTACC
GGGTTCGTACCCGGGAGAGCGTGCGTGGTGATGGTTTTGATCACTACATTTCCTTTGTTCGTGGTGATGA
AACCGAATGTCTGAATCGTCAGGAAGCGGTCTCGCTGACTCTCACGTGCACCAATCGCCAGTTGCCACAA
CAACTGGCCGTCGGGGAAGTGTGCATGGCCACCGAGAGTACACCGGCCTTTGCCGCATTCAGCAATATCA
CGCGCCCGACGGCGACCCTGCGGCCTACCCTGGATGGCAGCCTGTTGTGGACGCTGATATCCAACCTGTC
ATTGAACTACCTGTCGATGCTGGATGTGGATGCCCTGCGCACCGTGCTGCGAGTGTATGACTTCCGGGCC
CTCGTCGACCGACAGGCTGAGCGGGTGTCCCAGAAGCGGCTGGCGGGTATCACGGGCATCACCACCAAGC
CGGTTGACCGCATGATTCGCGGGCTGCCGGTGCGCGGTATCCGCTCAGAGCTGAAGCTGGATCAGCATGG
GTTTGCCAGTGAAGGTGACCTCTACCTGTTCGGCACGGTGTTGAGTCAGTTTTTTGCGCTTTACGCGAGT
ATCAATGCGTTTCACCAACTGGAAGTGGTGAATACAGACAATCAGGAACGGTACACATGGACGTTACAGC
AAGGTCAGCAGCCGCTGATGTAG