SecReT6
Protein ID: 387816015
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3633
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3763127..3763564 [-]
Producthypothetical protein
NoteTssE
UniProt IDH8W8Q3
KEGG IDmhc:MARHY3633
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.10E-20, Aligned region: 36..124
Protein Sequence: 145 a.a.     [Download]
>gi|387816015|ref|YP_005431510.1| hypothetical protein MARHY3633 [Marinobacter hydrocarbonoclasticus ATCC 49840]
MFGGTGTDGVRNTGSLFERLEQAAAPAGQSMGEFTHVVESIKRHLVRLLNAHPGNSSSAPDLGLLDFNDA
TLGTHDLSIQIRGAIRQCIEKFEPRVKRVDVVAMPPGPDPLQLKFQVTVYLNVAGSDDRTTIDLVLDDKR
YCRVV
 
Nucleotide Sequence: 438 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3763564-3763127 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
GTGTTCGGCGGCACCGGCACTGACGGCGTTCGCAACACCGGCAGCCTGTTTGAACGGCTTGAACAGGCTG
CCGCTCCTGCGGGCCAGAGCATGGGGGAGTTCACCCATGTGGTGGAGTCCATCAAGCGCCACCTGGTGCG
ACTGCTGAACGCCCACCCGGGCAACAGCAGCAGCGCACCGGATCTTGGCTTGCTGGATTTCAACGACGCC
ACTCTGGGCACTCATGACCTGAGCATCCAGATCCGTGGGGCCATCCGTCAGTGCATCGAGAAGTTTGAGC
CGCGGGTTAAGCGGGTGGATGTGGTGGCTATGCCACCGGGCCCGGATCCGTTGCAGTTGAAGTTCCAGGT
GACGGTCTACCTGAACGTTGCAGGAAGCGATGATCGGACGACGATAGACCTGGTTTTGGATGATAAGCGG
TACTGCCGGGTTGTTTAG