SecReT6
Protein ID: 387816016
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3634
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3763568..3765049 [-]
Productsecretion system protein (EvpB-like)
NoteTssC
UniProt IDH8W8Q4
KEGG IDmhc:MARHY3634
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-193, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|387816016|ref|YP_005431511.1| secretion system protein (EvpB-like) [Marinobacter hydrocarbonoclasticus ATCC 49840]
MSDTAVQQSAASESVAEGSLLDQVMANSRMAPADEGYDVARKGVATFIANLLKSDEKGQPVNKALVDQMV
VELDRKISAQMDEILHAPKLQELESSWRGLKLMVDRTDFRENIKVDILHATKTELLEDFEFAPDVTQTGF
YKHIYAAEYGQFGGEPVGAIVGNYAFSPSTPDMKLLQYVSSVGAMSHAPFLSSVAPSFFGVDSYQELPAI
KELSAVFEGPKYAKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPVRSFNYKEDVSGDHEHYLWGNTSY
LLATRLTESFAKYRWCPNIIGPQSGGAVEDLPVHTFESFGQLEAKIPTEVLITDRREYELAEEGFIALTM
RKGSDNAAFFSANSVQKPKQFPNTKEGKEAETNYKLGTQLPYMMIVNRLAHYIKVLQREQIGSWKERQDL
ERELNTWIRQYVADQENPPADVRSRRPLRAAKVEVSDVEGDPGWYQVSLAVRPHFKYMGANFELSLVGRL
DKD
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3765049-3763568 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGTCTGATACTGCTGTGCAGCAATCTGCTGCCTCCGAATCCGTAGCAGAAGGCTCTCTGCTTGACCAGG
TCATGGCCAACAGCCGTATGGCGCCGGCCGATGAAGGCTACGATGTTGCCCGTAAAGGGGTGGCCACGTT
TATTGCCAACCTGCTGAAGAGCGATGAAAAAGGCCAGCCAGTCAACAAGGCGCTGGTCGACCAGATGGTG
GTCGAGCTGGATCGTAAAATCAGCGCCCAGATGGATGAGATTCTGCACGCGCCCAAGCTGCAGGAGCTGG
AATCGTCCTGGCGCGGACTGAAACTGATGGTGGATCGCACCGATTTCCGCGAGAACATCAAGGTGGATAT
CCTCCATGCCACCAAGACCGAGCTGCTGGAAGATTTCGAATTTGCTCCGGACGTGACCCAGACCGGCTTC
TACAAGCACATTTATGCCGCCGAGTATGGTCAGTTCGGTGGTGAGCCGGTGGGCGCGATTGTCGGCAACT
ACGCCTTCAGCCCATCAACGCCGGACATGAAGCTGCTGCAGTACGTGTCGTCGGTTGGCGCCATGTCCCA
CGCGCCCTTCCTGTCCTCGGTTGCACCGTCGTTCTTCGGCGTCGACAGCTACCAGGAACTGCCGGCTATC
AAAGAGCTGAGCGCCGTTTTCGAAGGGCCGAAATACGCCAAGTGGCGTTCCCTGCGGGAATCTGAGGATG
CCCGTTACCTGGGCCTGACCGCACCGCGCTTCCTGCTGCGGGTGCCTTACGATCCGACTGAAAACCCGGT
GCGCAGCTTCAACTATAAGGAAGATGTCTCCGGTGACCACGAGCATTACCTGTGGGGCAATACCTCCTAC
CTGCTGGCCACACGCCTGACCGAGAGCTTCGCCAAGTACCGTTGGTGCCCGAACATCATTGGCCCACAAA
GTGGCGGTGCGGTGGAAGATCTGCCGGTGCACACCTTCGAGTCCTTCGGTCAGCTGGAAGCCAAGATTCC
GACTGAGGTGCTGATTACCGACCGTCGCGAATACGAGCTGGCGGAAGAAGGTTTCATCGCCCTGACCATG
CGCAAGGGCAGCGATAACGCCGCGTTCTTCTCCGCCAACTCGGTGCAGAAGCCCAAGCAGTTCCCGAACA
CCAAGGAAGGCAAGGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCGTTAA
CCGCCTGGCCCACTACATCAAGGTGCTTCAGCGTGAGCAGATCGGCTCCTGGAAAGAGCGTCAGGATCTG
GAGCGGGAACTGAACACCTGGATTCGCCAGTACGTGGCCGACCAGGAAAACCCGCCTGCAGACGTCCGCA
GTCGCCGCCCCTTGCGTGCCGCGAAAGTGGAAGTCTCCGATGTAGAAGGCGATCCGGGCTGGTACCAGGT
CTCCCTGGCAGTGCGTCCGCACTTCAAATACATGGGCGCCAACTTCGAACTCTCGCTGGTTGGCCGACTG
GACAAGGATTAA