SecReT6
Protein ID: 387816017
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3635
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3765111..3765608 [-]
Productsecretion system protein (EvpA-like)
NoteTssB
UniProt IDH8W8Q5
KEGG IDmhc:MARHY3635
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-58, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|387816017|ref|YP_005431512.1| secretion system protein (EvpA-like) [Marinobacter hydrocarbonoclasticus ATCC 49840]
MSAKDGSVAPKERINIKYVPATGDQQAETELPLKMFVVGDFKGHAEETPIEDRKAISVDKNNFRSVMKEA
GLTLSTSVSNKLEDGADDLPVNLEFQGLEDFSPDSIARQVPELKKLIELREALVALKGPLGNVPSFRSKL
QELLDNDDAREKLLAELELATDGGE
 
Nucleotide Sequence: 498 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3765608-3765111 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGTCTGCCAAAGACGGTTCCGTTGCGCCGAAAGAGCGCATCAATATCAAGTATGTCCCCGCCACAGGCG
ATCAGCAGGCCGAAACCGAACTACCACTGAAGATGTTCGTGGTTGGTGATTTCAAGGGTCACGCTGAAGA
AACCCCCATTGAAGACCGTAAGGCCATTTCCGTCGACAAGAACAACTTCCGTTCTGTCATGAAGGAAGCG
GGTCTGACGCTTTCCACCAGTGTTTCCAACAAGCTCGAAGACGGTGCCGACGACCTCCCCGTGAATCTCG
AATTCCAGGGGCTCGAAGACTTCTCTCCGGACAGCATTGCCCGCCAGGTCCCTGAGCTCAAGAAGCTGAT
TGAGCTGCGTGAAGCCCTGGTTGCCCTCAAGGGCCCGCTGGGCAACGTGCCTTCGTTCCGTTCCAAGCTG
CAGGAGCTGCTGGACAACGACGACGCCCGGGAAAAGCTGCTGGCTGAACTTGAGCTGGCCACCGACGGCG
GCGAGTAA