SecReT6
Protein ID: 387824961
SecReT6 ID773
T6SS typeii
Gene symbol-
Locus tagFN3523_1378
StrainFrancisella cf. novicida 3523
Repliconchromosome [GenBank: NC_017449] [Browse all T6SS(s) in this replicon]
Location [Strand]1413848..1414369 [+]
Producthypothetical protein
NoteIglG
UniProt IDF4BGT7
KEGG IDfcn:FN3523_1378
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.80E-18, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|387824961|ref|YP_005824432.1| hypothetical protein FN3523_1378 [Francisella cf. novicida 3523]
MLDIINDSLKRLEEIATNNQSTSSSVSDLISELNNIRTLLTQTKLNLSNNASILTPSMGAQIKCSFSLAP
GTYISTRIKTLASNLPASNITDSKLGVNILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVNFINSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|387823583|ref|NC_017449.1|:1413848-1414369 Francisella cf. novicida 3523 chromosome, complete genome
ATGTTAGATATTATAAATGACTCTCTAAAACGTCTAGAAGAAATAGCAACCAATAATCAAAGTACTAGTA
GTTCAGTATCTGATTTAATCTCAGAATTAAATAATATAAGAACCTTACTAACTCAAACAAAACTTAACTT
ATCGAACAATGCATCAATATTAACCCCATCAATGGGCGCTCAAATTAAATGTTCATTTAGTCTAGCACCA
GGAACCTATATTAGTACAAGAATAAAAACACTAGCAAGTAACTTACCAGCTTCAAATATCACTGATTCTA
AACTTGGAGTCAACATATTACCTTTTGCTGGATGTACAAATCCAGCAAACCCCACAATGAATCCATTTAG
CTTCCCTTGGGTATGTATTCCAAATTTATCTGCATTTATTCCAACAAATCCTACCACGCTGCTAGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTCGCCCCAGGAGGTATAGTTAATTTTATTA
ATAGTGGACAAATAAATGTAAAAACATCTTAA