SecReT6
Protein ID: 387830658
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2605
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2836787..2837287 [+]
Producthypothetical protein
NoteTssB
UniProt IDD2NLX1
KEGG IDese:ECSF_2605
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|387830658|ref|YP_003350595.1| hypothetical protein ECSF_2605 [Escherichia coli SE15]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2836787-2837287 Escherichia coli SE15, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGATTACAGTAACGGAAAAGAGCA
GCGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGCGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTAATGAACAAAATATCGCGCTTG
AATTTAAAAGCCTGAAGGATTTTGAGCCCGAACAGGTAGCAAAAAATATTCCACAACTTCGTGTATTACT
CGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA