SecReT6
Protein ID: 387830659
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2606
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2837346..2838884 [+]
Producthypothetical protein
NoteTssC
UniProt IDD2NLX2
KEGG IDese:ECSF_2606
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|387830659|ref|YP_003350596.1| hypothetical protein ECSF_2606 [Escherichia coli SE15]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDSWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDV
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2837346-2838884 Escherichia coli SE15, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATCGATTCATGGCAAAA
CAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCTATCCACGTTCTGCTTTCCTGT
CTGGCGAAGTCTGGCGAGGACGTGGTTAAACTCGACAAAAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCAGTCATGCACCATCCGGAATTCCAGAAAGTCGAGTCGCTCTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAACTGCTGGATGTC
AGTAAAGAACATCTGCGGCAGGACTTTGATGATTCTCCGGAAATCATTCAAAGTGGTTTATATCGCCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGAATTCGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTCTCTGCTGCATCACATATGCCCTTT
ATCGGTTCCGTCGGACCGAAGTTCTTCCTTAAAAACTCGATGGAAGAAGTCGCCGCAATTAAAGATATCG
GCAACTATTTTGACCGCGCGGAATATATCAAATGGAAGTCGTTCCGCGATACCGACGACAGTCGCTACGT
GGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACAGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCGCAGGCGGGTGG
CGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCAGCGAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGTCGTATTAACGCCCGTTTGCCCTATATTTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAGCTTAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA