SecReT6
Protein ID: 387830664
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2611
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2843306..2845942 [+]
ProductClp ATPase
NoteTssH
UniProt IDD2NLX7
KEGG IDese:ECSF_2611
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 238..258
AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 609..774
AAA [PF00004], Evalue: 6.30E-20, Aligned region: 22..57
AAA [PF00004], Evalue: 6.30E-20, Aligned region: 240..352
AAA [PF00004], Evalue: 6.30E-20, Aligned region: 614..737
AAA_5 [PF07728], Evalue: 2.80E-14, Aligned region: 240..264
AAA_5 [PF07728], Evalue: 2.80E-14, Aligned region: 337..370
AAA_5 [PF07728], Evalue: 2.80E-14, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 2.80E-14, Aligned region: 780..855
AAA_16 [PF13191], Evalue: 9.90E-14, Aligned region: 217..262
AAA_16 [PF13191], Evalue: 9.90E-14, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 9.90E-14, Aligned region: 486..558
AAA_16 [PF13191], Evalue: 9.90E-14, Aligned region: 596..649
AAA_16 [PF13191], Evalue: 9.90E-14, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 9.90E-14, Aligned region: 753..827
AAA_22 [PF13401], Evalue: 8.70E-09, Aligned region: 239..325
AAA_22 [PF13401], Evalue: 8.70E-09, Aligned region: 359..400
AAA_22 [PF13401], Evalue: 8.70E-09, Aligned region: 480..514
AAA_22 [PF13401], Evalue: 8.70E-09, Aligned region: 610..650
AAA_19 [PF13245], Evalue: 9.00E-08, Aligned region: 237..261
AAA_19 [PF13245], Evalue: 9.00E-08, Aligned region: 609..635
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 24..73
Clp_N [PF02861], Evalue: 4.10E-07, Aligned region: 108..124
Arch_ATPase [PF01637], Evalue: 5.00E-07, Aligned region: 218..389
Arch_ATPase [PF01637], Evalue: 5.00E-07, Aligned region: 606..626
Arch_ATPase [PF01637], Evalue: 5.00E-07, Aligned region: 682..695
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 240..300
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 450..501
AAA_25 [PF13481], Evalue: 6.50E-07, Aligned region: 609..642
AAA_17 [PF13207], Evalue: 2.40E-06, Aligned region: 240..342
AAA_17 [PF13207], Evalue: 2.40E-06, Aligned region: 612..648
AAA_14 [PF13173], Evalue: 2.90E-06, Aligned region: 240..337
AAA_14 [PF13173], Evalue: 2.90E-06, Aligned region: 611..695
IstB_IS21 [PF01695], Evalue: 3.80E-06, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 3.80E-06, Aligned region: 498..531
IstB_IS21 [PF01695], Evalue: 3.80E-06, Aligned region: 613..632
Zeta_toxin [PF06414], Evalue: 5.40E-06, Aligned region: 233..267
Zeta_toxin [PF06414], Evalue: 5.40E-06, Aligned region: 604..653
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 111..135
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 240..336
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 613..637
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 224..254
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 612..730
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 762..819
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 240..278
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 614..643
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 609..624
DUF2075 [PF09848], Evalue: 0.0013, Aligned region: 242..342
DUF2075 [PF09848], Evalue: 0.0013, Aligned region: 612..635
AAA_24 [PF13479], Evalue: 0.0021, Aligned region: 240..255
AAA_24 [PF13479], Evalue: 0.0021, Aligned region: 614..635
T2SE [PF00437], Evalue: 0.0028, Aligned region: 224..258
T2SE [PF00437], Evalue: 0.0028, Aligned region: 609..691
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 241..262
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 614..635
ResIII [PF04851], Evalue: 0.0083, Aligned region: 189..261
ResIII [PF04851], Evalue: 0.0083, Aligned region: 308..322
ResIII [PF04851], Evalue: 0.0083, Aligned region: 613..635
Protein Sequence: 878 a.a.     [Download]
>gi|387830664|ref|YP_003350601.1| Clp ATPase [Escherichia coli SE15]
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDIDTLWQS
LLAHLDTLPRPVRERPQLSEPLAALIRQAWLIASLEGDDPQIRSQHLLMALTEKPMLPACNDLWVLLSLS
RVQLERLRPLLDAQSDECPARQPQVTEPLTSAQPGAATTDAPAKTLTGKQDDALLAVLNRFTEDVTEKAR
SGRIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRITEGNVPDSLKTVHIRTLDLG
LLQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAA
TTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLHARLAALDIEREAIEQDSVFYPETSPERLAELTDLRDE
LQAEAGHLEAQYQQEKALAQQIMTLRQEGTDSSELQQQLRTHQGFAPLLALDVDARAVATVVADWTGIPL
SSLLRDEQSDLLSMEQSLENRVVGQSPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTGKTETALTL
ADTLFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMN
LFYQVFDRGFMRDGEGRVIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLRNHFQPALMA
RFQTVIYRPLGQEAMRTIVEMKLAQVVRRLHQHYGLETEINDSLYDQLTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAVHHKPARLRLGWDEEDGIVLEFDEK
 
Nucleotide Sequence: 2637 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2843306-2845942 Escherichia coli SE15, complete genome
ATGACCGGAAATCACCCCGCCGCGCTGCTGCGTCGCCTTAACCCATACTGTGCACGGGCGCTGGACGCTG
CCGCCTCACTGTGTCAGACCCGCGCCCATGCGGAAATAACCATTGAACACTGGCTGCTGAAACTGCTGGA
GCAGGGAGAAGGCGATATCACGGTGATTGCCCGCCGCTATGAATGGGATATCGACACGCTCTGGCAGTCT
CTGCTGGCACATCTGGACACCTTACCCCGCCCGGTCCGCGAACGTCCTCAACTTTCTGAACCGCTGGCAG
CGCTTATCCGACAGGCGTGGCTGATAGCGTCACTGGAAGGCGACGATCCACAAATCCGCAGCCAGCATCT
GCTGATGGCGCTGACAGAAAAACCGATGCTGCCCGCCTGTAATGACCTGTGGGTATTGCTGAGCCTGAGC
CGTGTGCAGCTTGAGCGGCTGCGTCCCCTGCTGGATGCGCAGTCGGATGAATGTCCGGCACGTCAGCCAC
AGGTCACCGAACCGCTGACATCCGCGCAACCCGGGGCGGCAACGACGGACGCACCGGCAAAAACGCTGAC
GGGGAAACAGGATGACGCCCTGCTGGCGGTGCTTAACCGCTTTACCGAAGACGTGACGGAAAAAGCCCGC
AGCGGGCGAATCGACCCGGTATTCGGGCGCGACACGGAAATTCGCCAGATGGTCGATATCCTCTCCCGTC
GCCGCAAAAACAACCCGATTCTGGTGGGAGAACCGGGGGTGGGCAAAACCGCGCTGGTGGAAGGGCTGGC
GCTGCGTATCACCGAAGGCAACGTGCCGGACAGCCTGAAAACGGTGCATATCCGCACACTGGACCTCGGT
CTGTTACAGGCTGGCGCGGGCGTTAAAGGTGAATTTGAACAGCGGCTGAAAAATGTCATCGATGCAGTGC
AGAAATCACCGGAGCCGGTACTGCTGTTTATTGATGAAGCCCATACCATTATCGGTGCGGGTAATCAGGC
AGGCGGCGCGGATGCGGCGAACCTGCTGAAACCGGCGCTGGCAAGGGGCGAACTGCGCACCATCGCGGCG
ACCACGTGGAGCGAATACAAACAGTATTTTGAGCGCGACGCCGCGCTGGAACGCCGCTTCCAGATGGTGA
AAGTCGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGGGGACTCAAGGCCCGCTATGCACAGCA
CCACGGCGTACATATGCTGGACAGCGCCATTCAGACCGCCGTGCGCCTGTCGCGCCGCTATCTGACCGGA
CGCCAGTTGCCGGACAAAGCGGTTGATTTGCTGGATACCGCCGGGGCAAGAGTCCGCATGAGCCTTGACA
CTCTGCCGGAGCCGTTGACGCAGCTTCATGCGCGACTGGCGGCGCTGGATATCGAGCGGGAGGCGATTGA
GCAGGACAGCGTGTTTTATCCCGAAACCAGCCCGGAGCGGCTGGCGGAACTGACCGATTTGCGTGATGAG
CTACAGGCAGAAGCCGGGCATCTGGAAGCGCAGTATCAGCAGGAAAAGGCACTGGCGCAGCAGATTATGA
CGTTGCGTCAGGAAGGAACAGACAGCTCTGAACTGCAACAGCAACTGCGGACGCATCAGGGCTTTGCACC
GCTGCTGGCGCTGGATGTGGACGCCCGCGCCGTCGCCACGGTGGTGGCGGACTGGACCGGCATCCCGCTC
TCTTCCCTGCTCAGGGACGAGCAGAGCGACCTGCTCAGTATGGAACAGAGTCTTGAAAACCGCGTTGTCG
GGCAAAGCCCGGCGCTCTGCGCCATCGCACAGCGGCTGCGGGCGGCTAAAACCGGCCTCACGCCGGAGAA
CGGCCCACAGGGGGTATTCCTGCTGACCGGCCCCAGCGGCACCGGCAAAACCGAAACTGCGCTCACACTG
GCCGACACCCTGTTTGGTGGTGAAAAATCCCTTATCACCATTAATCTTTCGGAATACCAGGAACCGCATA
CCGTTTCCCAGTTGAAAGGCTCGCCTCCAGGCTACGTTGGTTACGGTCAGGGTGGCGTACTTACCGAAGC
CGTTCGCAAACGCCCTTACAGCGTGGTGCTGCTCGACGAAGTGGAAAAGGCGCATCGCGACGTGATGAAC
CTGTTCTATCAGGTGTTCGACCGGGGCTTTATGCGCGACGGCGAAGGGCGGGTAATCGACTTCCGCAACA
CCGTCATTCTGATGACCGCCAATCTGGGCAGCGACCACATCATGCAACTGCTGGAGGAAAAACCGGACGC
CACGGACGCAGACCTGCATGAACTGCTGTATCCCCTTCTGCGAAACCATTTTCAGCCTGCACTGATGGCG
CGTTTTCAGACGGTGATTTACCGCCCGCTGGGACAGGAGGCGATGCGCACCATTGTGGAAATGAAACTGG
CGCAGGTGGTCCGCCGTCTTCACCAGCACTACGGACTGGAAACGGAAATCAACGACAGCCTGTATGACCA
GCTTACCGCCGCCTGCCTGCTGCCGGATACCGGGGCGCGCAATATCGACAGCCTCCTGAACCAGCAAATC
CTGCCGGTCTTAAGCCAGCAGTTGCTGGCACAGCAGGCCGTGCATCATAAGCCTGCCCGACTGCGGCTTG
GCTGGGATGAGGAGGACGGGATTGTACTGGAATTTGATGAGAAATAA