SecReT6
Protein ID: 387830665
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2612
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2845942..2848461 [+]
Producthypothetical protein
NoteTssI
UniProt IDD2NLX8
KEGG IDese:ECSF_2612
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-64, Aligned region: 34..351
DUF2345 [PF10106], Evalue: 7.70E-46, Aligned region: 555..581
DUF2345 [PF10106], Evalue: 7.70E-46, Aligned region: 606..747
T6SS_Vgr [PF13296], Evalue: 2.90E-34, Aligned region: 484..588
T6SS_Vgr [PF13296], Evalue: 2.90E-34, Aligned region: 585..612
Phage_base_V [PF04717], Evalue: 3.80E-14, Aligned region: 396..477
Protein Sequence: 839 a.a.     [Download]
>gi|387830665|ref|YP_003350602.1| hypothetical protein ECSF_2612 [Escherichia coli SE15]
MEALMNVQFFDHAHHKLKIRGLKSPVDVLTFTGHEQLSSPFRYDIEFTSTDKAIEPESVLMQDGAFSLSA
PPVQGMPVQVPLRTLHGVITSFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRER
HQMRGQDFVFNLKNEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGL
TLPLRHPSGLFDGETEAVWGLNSAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADN
FLQKGDKEAAESGAFYARIRHERYLNEQAILQGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTASA
ARDRSYELTFTAIPYSERYGYRPALIPCPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKP
GYESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTP
ANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGAVRAKKGIFISADAQDK
AQGKVREMAPAMAILDGAQSQMKSLSTDAQTANADPADLSSQIALLQQSVKDLTQAAILLSAPKGVAIAS
GEHLQLAASKNLIANAGNHADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAISVQAQNDLMELLAQKS
IEITSTEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSE
DFNQSFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDEIN
 
Nucleotide Sequence: 2520 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2845942-2848461 Escherichia coli SE15, complete genome
ATGGAGGCTCTTATGAACGTACAGTTCTTCGACCACGCACACCACAAGCTCAAAATTCGCGGCCTGAAAA
GCCCGGTGGACGTGCTGACTTTTACAGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTGAGTT
TACCAGTACCGATAAAGCCATCGAGCCGGAGTCGGTACTGATGCAGGACGGCGCATTCAGCCTGAGCGCC
CCGCCGGTACAGGGGATGCCGGTGCAGGTCCCCCTGCGCACCCTGCACGGCGTCATTACCAGCTTTAAAC
ACCTCTCATCGTCACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCG
CAGCCGCCAGAACGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGC
CATCAAATGCGCGGTCAGGACTTCGTGTTTAACCTCAAAAACGAATACCCGGCCCGTGAACAGGTGATGC
AGTACGGTGAGGACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAGGTGGGTATCTGGTTCCGCTTTGC
CACCGACGCCCGGCTGAAAATCGAAGTTGTCGAGTTTTATGACGACCAGAGCGGCTATGAGCGCGGACTG
ACGCTGCCGCTTCGTCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGTTGAACAGCG
CGTACAGCGTGGTGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATGAC
CACAGGCCAGCATGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTACGCTGACAAC
TTCCTGCAAAAAGGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACGCT
ATTTGAATGAACAGGCCATTCTACAGGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAA
AGTTCAGGGTGACGACGCGCCAGCGGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCG
GCGCGTGACCGCAGCTATGAACTGACGTTTACCGCCATCCCGTACTCAGAACGCTATGGCTACCGCCCGG
CGCTTATCCCCTGCCCCGTGATGGCCGGCACGCTCCCGGCACGGGTCACCAGCACGGTGAAGAACGACAT
CTACGCCCATATCGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCG
GGTTATGAAAGCCTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGC
TGCTGGCGGGAACGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCCGGGGT
AAAACACGACTCGGCACACACCGACCATGTGACCATTCAGAACTACAAGCGTAACGTGCTGCGCACCCCG
GCGAACAACAAAATCCGCCTCGACGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCG
GCAAGAGCCAGCTAAACCTCGGCCATCTGGTGGATGCCGGAAAACAGCAGCGCGGGGAAGGTTTTGAACT
GCGTACCGATCTGTGGGGTGCAGTACGGGCAAAGAAAGGCATCTTTATCAGCGCCGATGCGCAGGACAAG
GCGCAGGGTAAGGTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGAAGT
CGCTGTCCACTGATGCGCAGACGGCGAATGCCGATCCGGCAGATCTGTCATCACAGATAGCGCTGTTGCA
GCAGAGTGTAAAAGATCTGACGCAGGCTGCGATCCTGCTAAGCGCACCCAAAGGCGTGGCGATCGCCAGC
GGAGAGCACCTGCAACTGGCGGCGTCGAAAAACCTGATCGCGAACGCAGGAAATCACGCTGATATCGGTG
TCGTGAAGAATATGTTTATCGGCGTGGGTCAGGCGCTGAGCGTGTTTGTACGCAAAGCGGGTATCAAACT
GTTTGCCAATAAAGGGGCGATCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCGCAGAAATCG
ATAGAGATCACCAGTACGGAAGATGAGATTAAAATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTG
GCAGCTACATCCGGCTGGATGCCTGTGGGATAGAGGCCGGTACGCCGGGAGAATATAACGTTAAGGCGGG
ATATTACGGGCGTAAGCCGAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAG
GATTTTAATCAGAGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAAC
TAGAACTGGAAAGTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTC
TGATAAGGAGGAGGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGAAATTAATTAA