SecReT6
Protein ID: 387830673
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2620
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2856899..2858509 [+]
Producthypothetical protein
NoteTssA
UniProt IDD2NLY6
KEGG IDese:ECSF_2620
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-20, Aligned region: 67..126
Protein Sequence: 536 a.a.     [Download]
>gi|387830673|ref|YP_003350610.1| hypothetical protein ECSF_2620 [Escherichia coli SE15]
MSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNKLSGADTGLI
CQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRKMALEWLAGE
KMLDSLARYPEVAKEDFANIVAALNQLSVSFTAWPEDQHSPSLMPLINALESRLAQSGGMNAVVPQNSSG
VPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAP
PRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALAKAGAPWDRWTAVIRQDLALLL
ERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGV
EAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFEVKARQ
LKLLRLRAHRYADKALLNRKMEILLGTLVAIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2856899-2858509 Escherichia coli SE15, complete genome
ATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCGACCGGGATGCACTGGATGTGGCGCGAA
CACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAGACACGCCGGTCGGGGAAGACCCCGG
CTACCACGACGATTTCCTGCGTATCCGCGACGAAATGAACAAACTGTCCGGTGCCGATACCGGCCTTATC
TGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACGTGCGCATCGCCACTTACTACATCTGGG
CGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAAGGACTGGCGCTGTTAGCCGGGCTGGTGGAACG
CTTCGGTACGCAACTGCTGCCCTCGCGACCGGCAAGCCGAAAAATGGCGCTGGAGTGGCTGGCGGGGGAA
AAGATGCTCGACAGCCTTGCCCGCTACCCGGAGGTGGCAAAAGAGGATTTTGCGAACATTGTTGCCGCTC
TTAATCAACTGTCGGTTTCCTTCACTGCATGGCCCGAAGACCAGCATTCCCCCTCCCTGATGCCGCTGAT
TAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAACGCGGTGGTGCCGCAAAACAGCAGCGGC
GTTCCGGCACCGTCTTCCCCGGTGGATGCGCCGCAGGTACAGACCATCACCTCCGGGCGCGACCTACTCG
ACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTCAGCACACCGGCTGAT
GAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGACGTGGACGGCAAAACCCGGCTGGCCCCG
CCGCGCACCGAATCACGCAACCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGACGGAACTGCTGGAGC
AGGCCGACCTGATGTTCAGCACCGGTGTCAGCCATTTCTGGCTGGATATCCAGTGGTATCTGCATCAGGC
GCTGGCGAAGGCGGGCGCACCGTGGGACAGATGGACAGCGGTTATCCGTCAGGACCTGGCGCTGCTGCTG
GAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCACGCCGTTTGCCGATGAGGTGACGCGCA
ACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAAAGCCGCTGTGCCGAC
AGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGAGATGGCTGACAGTCAGGGCGTG
GAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGACAGCGCCTGTTATTGCGAC
TGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCTGCTGGAAGAACTGGA
TACCGCCGCACAGGGAATAACGCTGACACAGTGGGAGCCAGAGCTGCTGTTTGAAGTAAAAGCCCGACAA
CTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAGCCCTGCTGAACCGAAAAATGGAAATCC
TGCTGGGAACGCTGGTGGCAATCGATCCGGTACGGGCAGCGGTATTGTGTGATACGCAACATAAGGACTG
A