SecReT6
Protein ID: 387830675
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2622
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2860908..2862668 [+]
Producthypothetical protein
NoteTssF
UniProt IDD2NLY8
KEGG IDese:ECSF_2622
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.30E-185, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|387830675|ref|YP_003350612.1| hypothetical protein ECSF_2622 [Escherichia coli SE15]
MDDLTQRYFEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELTTDHQQMKQSDTLKEFQVLSRPIGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPLYLSADSPVACALHRALTLGTQQFWLRLPGQGR
RVLDAHFSPMGFDDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVLLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDQMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLAAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2860908-2862668 Escherichia coli SE15, complete genome
ATGGACGACCTGACCCAACGCTACTTTGAGGCCGAAATGCGCTACCTGCGTGAAGCGGGGAAAGAATTTG
CGCAGGCTTACCCCGACCGCGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCGCACTACCTGCGCACTATTCCGTCGCTTTCCGTGGTCG
AACTGACCACGGATCACCAACAAATGAAGCAAAGTGATACGCTGAAAGAGTTTCAGGTGCTATCCCGTCC
CATCGGCGAACGCAGAACCCGCTGCGTCTACAGCGCCACGCGGGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGAATGCGGCCCGC
TGGTTGGTGACTGGTCACAGATTGATTTATCCCGCCTGCCGCTGTACCTCAGTGCCGACAGCCCGGTGGC
CTGTGCGCTGCACCGGGCTTTAACGCTTGGTACGCAGCAGTTCTGGCTGCGTCTGCCAGGGCAGGGACGC
CGTGTGCTGGACGCGCACTTTTCCCCGATGGGTTTTGATGACGATGACCGACTGTGGCCGAAAGGCGAAT
CGGCGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTCGTGGCGCT
GAACGGGCTGGAGCAGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGTTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAACCTGT
TTCCGCTGGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTGCGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTGCCATTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCCTGCATGACACCTGGCTGATTCTGGGCGGCGATGCGTTTGA
TACTGACCAGATGCTGGAGGATGAAACCCTGTCCTTAAGCCTGACCGGTACTAACGGGCAGCTTCCCCGT
AAAGCTTTACAGAGCACGCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGAGTGCGCAACC
TGTGCGCCCCGACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGCGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTCTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTAACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA