SecReT6
Protein ID: 387830676
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2623
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2862632..2863711 [+]
Producthypothetical protein
NoteTssG
UniProt IDD2NLY9
KEGG IDese:ECSF_2623
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|387830676|ref|YP_003350613.1| hypothetical protein ECSF_2623 [Escherichia coli SE15]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQRQQNAPLGSTDSPAADAVRFRPHPGMGFPVSELKNV
ERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSPISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLTPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2862632-2863711 Escherichia coli SE15, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGCGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAGCCC
CGCCGCCGATGCGGTGCGCTTTCGTCCTCATCCGGGGATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGTGGACAATCCCGACGCGCCACCCACAGTGCGCACCACTTTTCTCGGCCTGTACGGCGTGG
ATTCGCCACTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCGGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCAGTGGATGACATTTCCCGTTGCCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTTACGGCACTGGTGGGACTGCTTGCCCCGCTGACGAAAGCGACGGTGGTG
CCTCATGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACCCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGCACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGACTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAACACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA