SecReT6
Protein ID: 387830678
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2625
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2864232..2864660 [+]
Producthypothetical protein
NoteTssE
UniProt IDD2NLZ1
KEGG IDese:ECSF_2625
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-17, Aligned region: 26..114
Protein Sequence: 142 a.a.     [Download]
>gi|387830678|ref|YP_003350615.1| hypothetical protein ECSF_2625 [Escherichia coli SE15]
MPTPSLYEMLTFSFSGELPLEQVRERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2864232-2864660 Escherichia coli SE15, complete genome
ATGCCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGGTCA
GAGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGCCGGGCAGGCAC
GCTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGGATGGCTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAACAGGAGCGG
GCGTACTGA