SecReT6
Protein ID: 387830679
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2626
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2864660..2866036 [+]
Producthypothetical protein
NoteTssA
UniProt IDD2NLZ2
KEGG IDese:ECSF_2626
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 3.20E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|387830679|ref|YP_003350616.1| hypothetical protein ECSF_2626 [Escherichia coli SE15]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLCLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RPAQQNDKDASPPVSSPEISRQRAWPIFMAGMVVMACLGGTGLWVWSQLNQPDALIQRIQLSIMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEISPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2864660-2866036 Escherichia coli SE15, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCGGATGTGGACTGGCGTCAGGTGGA
AAAACTCTGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGCTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCAGGGAAATGAATCAACCGAAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACG
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCACCCGTGTCATCCCCTGAAATCTCCCGGCAGCGGG
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCTGTCTCGGCGGAACAGGATTATGGGTTTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTATCATGCCGTTGCCGCAGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTACCTGCCCGCTGGCCGCTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCACAGTGGCGTAAA
CAGCGGGAACTGAGCGCCCTGTCCGCAGAGGCACTGAATGGCTACGCACAGGCGCAGAGTCAGCTACAGC
GCCTGTCGGCACAACTGGATGCACTGGATGAGCGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGACAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGATTTCGCCGACGCTGTTGACGCAGATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA