SecReT6
Protein ID: 387868327
SecReT6 ID597
T6SS typei4b
Gene symbolevpA
Locus tagETAF_2199
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2506140..2506655 [+]
Producttype VI secretion system protein EvpA
NoteTssB
UniProt IDE0T3W8
KEGG IDetd:ETAF_2199
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-59, Aligned region: 10..163
Protein Sequence: 171 a.a.     [Download]
>gi|387868327|ref|YP_005699796.1| type VI secretion system protein EvpA [Edwardsiella tarda FL6-60]
MANESKQHTLDRVRSPRVQITYDVEIGDAQEMKELPFVMGVLGDYSGQPATPLPKLKERKFVSIDRDNFN
DVIKGVHPHLSFRTENTLSGDDSQLSVDLHFQSMADFTPERVAAQVEPLRKLMDIRSRLSDLKNKMYSNE
RLGEVLQGIIEDTEKLQSLGKETGFGEEKQP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2506140-2506655 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGGCAAATGAAAGCAAGCAGCATACGTTGGATCGAGTCCGCTCGCCAAGAGTGCAGATTACCTATGATG
TTGAAATTGGCGATGCGCAGGAAATGAAGGAGCTGCCATTTGTTATGGGAGTGCTCGGTGACTATTCAGG
GCAGCCGGCGACTCCGCTTCCCAAGCTGAAAGAGCGCAAATTCGTTTCGATTGATCGCGACAACTTCAAC
GATGTTATCAAAGGGGTGCATCCCCATCTGTCATTCCGCACCGAGAATACCCTGAGCGGAGATGACAGCC
AACTGTCGGTGGATCTGCATTTTCAGAGCATGGCGGATTTCACCCCAGAGCGGGTCGCGGCGCAGGTTGA
GCCGCTGCGCAAGCTGATGGATATCCGCAGCCGCCTCTCTGACCTGAAAAACAAGATGTACAGCAATGAA
CGCCTGGGTGAGGTATTGCAGGGCATCATTGAGGATACCGAAAAGCTGCAGAGTCTGGGTAAAGAGACCG
GCTTTGGCGAGGAGAAGCAGCCATGA