SecReT6
Protein ID: 387868328
SecReT6 ID597
T6SS typei4b
Gene symbolevpB
Locus tagETAF_2200
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2506652..2508139 [+]
Producttype VI secretion system protein EvpB
NoteTssC
UniProt IDE0T3W9
KEGG IDetd:ETAF_2200
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-192, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|387868328|ref|YP_005699797.1| type VI secretion system protein EvpB [Edwardsiella tarda FL6-60]
MSEQNLPESSAAESAALEGGLLDSIIAETRMARSDLEKARARDLLGEWVSEVLSGTVTVSGDVLASIEAR
IAQIDALLSAQLSAIMHEPAFQKLEGSWRGLHYLVHQSETGTGLKIRMLNVSRADLIRDFKSAAEFDQSA
LFKKVYEEEYGTFGGAPFAAMIGDYEFSNHPEDLFLLEEISHVAAAAHAPFLSAASAGMFGLDSLTELSI
PRDLAKGFDTVEYAKWKSLRQSEDARYIALALPHVLGRLPYGATTVPVESFNFEENVSGKEHGKYLWLNA
AYALGTRLTQAYAKYGWCAAIRGAEGGGLVEGLPAHTFTTDDGEVELKCPTEVAITDRREKELAELGFIA
LTHCKGTDYAAFFSTQSVQKPKEYDSDSANANARISCQLQYIMATSRFAHYLKSMVRDKIGSFMSRSECE
YFLNQWISNYVVGSDDAGQDIKAKYPLREARIDVSDIPGKPGFYKAVAYLKPHFQLEGLTASLRLVADLP
PPAQG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2506652-2508139 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGAGCGAACAGAACTTGCCAGAAAGTAGCGCCGCCGAGAGCGCTGCGCTAGAGGGCGGCCTGCTGGATA
GCATCATTGCGGAAACCCGGATGGCACGCAGTGATCTGGAGAAGGCGCGGGCCCGAGATCTGCTGGGGGA
ATGGGTCAGTGAGGTTCTGTCGGGCACCGTGACGGTATCCGGTGATGTGCTGGCCAGCATTGAGGCGCGT
ATCGCCCAGATCGATGCGCTGCTCTCCGCCCAGCTCTCCGCCATTATGCATGAGCCGGCGTTCCAAAAGC
TGGAGGGGTCATGGCGTGGGCTGCATTACCTGGTGCATCAAAGCGAAACCGGTACCGGCCTGAAAATCCG
CATGCTGAACGTCAGCCGAGCCGATCTGATCCGCGACTTTAAGAGCGCCGCCGAGTTTGATCAGAGCGCG
CTGTTCAAGAAAGTCTATGAGGAGGAGTACGGTACCTTTGGCGGCGCCCCCTTTGCGGCCATGATCGGGG
ATTATGAGTTCAGCAACCACCCGGAAGATCTGTTCCTGCTGGAGGAGATCTCACACGTTGCGGCGGCGGC
CCATGCCCCCTTCCTCTCTGCCGCCAGCGCAGGAATGTTCGGCCTGGATAGCCTGACAGAGCTGTCGATC
CCCCGGGATCTGGCCAAGGGCTTTGATACGGTTGAGTATGCCAAGTGGAAATCGCTGCGCCAGTCGGAGG
ATGCCCGCTATATCGCCCTGGCCCTACCCCACGTGCTTGGCCGACTGCCTTACGGCGCGACGACGGTGCC
GGTCGAGTCATTCAATTTTGAGGAGAATGTCAGCGGCAAGGAGCATGGCAAATATCTGTGGCTGAATGCC
GCCTATGCGCTGGGCACCCGCCTGACTCAGGCCTATGCCAAATATGGCTGGTGCGCCGCCATCCGGGGTG
CCGAAGGGGGAGGCCTGGTGGAGGGACTGCCGGCGCACACCTTTACCACCGATGATGGCGAAGTCGAGCT
CAAGTGCCCCACCGAAGTGGCCATTACCGATCGCCGAGAGAAGGAGCTGGCCGAGCTGGGATTTATCGCC
CTGACCCACTGTAAGGGGACCGACTATGCCGCCTTCTTTTCGACCCAGTCGGTGCAAAAGCCCAAGGAAT
ATGACAGTGACTCCGCCAATGCCAACGCCAGGATCTCCTGCCAGCTGCAATATATTATGGCCACCTCACG
CTTTGCCCATTATTTAAAATCGATGGTCCGCGACAAAATCGGCAGCTTTATGAGCCGCAGTGAATGTGAA
TATTTTCTCAATCAGTGGATCAGTAATTATGTGGTCGGCTCGGATGATGCTGGCCAGGATATCAAGGCGA
AATATCCATTACGGGAAGCCCGCATTGATGTCAGTGATATTCCGGGCAAACCGGGTTTCTATAAGGCGGT
AGCCTATTTAAAACCCCATTTCCAACTGGAGGGGCTGACCGCGTCTTTACGTCTGGTCGCCGATCTGCCG
CCGCCGGCGCAAGGCTAA