SecReT6
Protein ID: 387868332
SecReT6 ID597
T6SS typei4b
Gene symbolevpF
Locus tagETAF_2204
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2510491..2512332 [+]
Producttype VI secretion system protein EvpF
NoteTssF
UniProt IDE0T3X3
KEGG IDetd:ETAF_2204
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-214, Aligned region: 4..611
Protein Sequence: 613 a.a.     [Download]
>gi|387868332|ref|YP_005699801.1| type VI secretion system protein EvpF [Edwardsiella tarda FL6-60]
MVELLPYYNRELAFLRQLGREFASQYPKVAGRLLLEEGVSEDPHVERLIEAVAFLCARVHHKIDEQFPEI
TNALLGILYPHYLRPIPSLSLVQFSVDPAQTNLSGPLRLPRHTSLLSRQVDGMACRFRTAYPVEIWPVSV
IHAGFAPARQTSLSVQQQGSAGLICIRLQTHPGHHLNTLGMDRLRFFLQGEPAVVHTLYELLFNNVTKVV
LRAGSAEWTLPASIISPVGFDEDESLFDYDARSSQAYRLLHEYFAFPDKFLFFDMTELLQATPLPEACRE
IDLVIHLSAFEREGRLAKLTDTIDASTFRLGCSPVVNLFRQRAEPLQVTHRKTEYPIIPDVRRPWGMEVY
SVDAVSKLVKHDGQEKIKRYRPLFGLHHANDSEPQRVFWMENRRGGIRGDDPGMDVYLSLVDLDFDPNQS
SSETLSIDVTCTNREFPSLLPFGGDRGDFEVDGGSPVTRIHCLRKPTPTLRPAHGRAAMWRLISHLNLNL
LSITGENEEATEAFRELLGLYNFSDSPALRQQIAGIVSINSQPATARLCSRNQAAVVRGIEITLVLDESQ
FEGSGVYLFSAVVERFVSQYGAINSFTRLHVRTRQREQALKRWPPRAGKAVLS
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2510491-2512332 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGGTCGAGCTATTGCCCTACTATAACCGGGAGCTGGCGTTCTTACGTCAGTTGGGACGTGAGTTCGCCT
CCCAGTATCCCAAGGTGGCCGGACGCCTTCTGCTGGAGGAGGGGGTCTCGGAAGATCCCCATGTCGAACG
GCTGATCGAGGCCGTGGCATTTCTCTGCGCTCGAGTGCACCACAAGATTGATGAGCAGTTTCCCGAAATT
ACCAATGCGCTGCTGGGGATCCTGTATCCCCACTACCTGCGCCCGATCCCCTCGCTATCCCTGGTTCAGT
TTTCGGTCGATCCGGCGCAGACCAACCTATCGGGCCCACTGCGCCTGCCGCGGCATACCAGCCTGCTGTC
TCGCCAGGTAGATGGCATGGCATGCCGGTTTCGCACCGCCTACCCGGTGGAGATTTGGCCCGTGTCGGTC
ATCCATGCCGGCTTCGCCCCCGCGCGGCAAACCAGCCTGTCCGTGCAGCAGCAGGGAAGCGCCGGTCTGA
TCTGTATCCGCCTACAAACCCACCCGGGACATCATCTGAATACCCTGGGGATGGATAGACTGCGCTTCTT
TCTCCAGGGGGAGCCAGCCGTGGTGCACACCCTGTATGAGCTGCTGTTCAACAACGTGACCAAGGTGGTG
CTCCGCGCCGGATCGGCGGAGTGGACCCTGCCGGCCAGCATCATCTCACCGGTCGGATTCGACGAGGATG
AGAGCCTGTTTGACTACGATGCCCGCTCGTCCCAGGCCTACCGCTTACTGCACGAATACTTTGCCTTTCC
CGACAAGTTCCTGTTTTTTGACATGACCGAGCTGCTGCAGGCCACCCCGCTGCCGGAGGCCTGCCGGGAG
ATCGATCTGGTGATCCATCTGTCGGCGTTCGAGCGAGAGGGGCGCCTGGCCAAACTGACCGATACCATCG
ACGCCTCCACCTTTCGGCTGGGATGCAGCCCGGTGGTCAACCTGTTCCGGCAGCGGGCAGAGCCGTTGCA
GGTAACCCACCGTAAAACCGAGTACCCGATTATTCCCGATGTCCGCCGCCCCTGGGGCATGGAGGTCTAT
TCGGTCGATGCCGTCAGCAAGCTGGTCAAGCATGACGGGCAGGAGAAGATAAAACGCTATCGCCCCCTGT
TTGGCCTGCATCACGCCAACGACAGTGAGCCGCAGCGGGTATTCTGGATGGAAAACCGCCGCGGTGGGAT
CCGCGGGGATGACCCGGGCATGGATGTCTACTTATCCCTGGTGGATTTGGATTTTGACCCCAATCAGTCA
TCGTCGGAAACCCTGAGTATCGACGTGACCTGCACCAACCGAGAGTTTCCGTCCCTGCTGCCCTTCGGCG
GCGACCGGGGCGATTTCGAGGTGGACGGCGGCTCTCCCGTCACCCGCATCCACTGTCTGCGCAAGCCGAC
GCCCACCCTGCGCCCGGCCCACGGCAGGGCCGCCATGTGGCGTCTGATCTCCCACCTGAACCTGAACCTG
CTCTCCATCACCGGCGAAAACGAGGAGGCGACCGAGGCCTTCAGGGAGCTGCTCGGACTGTATAACTTCA
GCGACTCCCCCGCCCTGCGTCAGCAGATTGCCGGCATTGTCAGTATCAACAGCCAGCCGGCGACGGCGCG
CCTGTGCAGCCGGAATCAGGCGGCGGTGGTGCGGGGCATCGAAATCACCCTGGTGCTGGACGAGAGCCAA
TTTGAGGGCTCCGGGGTGTACCTGTTCAGCGCCGTGGTGGAGCGATTCGTCAGCCAGTACGGCGCCATCA
ACAGCTTTACCCGCCTGCACGTCCGCACCCGGCAGCGGGAACAGGCGCTCAAGCGCTGGCCGCCGCGGGC
GGGCAAGGCGGTGCTGTCATGA