SecReT6
Protein ID: 387868333
SecReT6 ID597
T6SS typei4b
Gene symbolevpG
Locus tagETAF_2205
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2512329..2513354 [+]
Producttype VI secretion system protein EvpG
NoteTssG
UniProt IDE0T3X4
KEGG IDetd:ETAF_2205
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-100, Aligned region: 16..317
Protein Sequence: 341 a.a.     [Download]
>gi|387868333|ref|YP_005699802.1| type VI secretion system protein EvpG [Edwardsiella tarda FL6-60]
MNDALSPKSMLEQLYARPYEFDFFQAVRILELQQLRCGCQELPLRFRTHLSLATPASSVYALQPPAADQP
QVMTINFMGLTGPSGALPTRYTEMLLARRLQHRDQTAHHFFDLLNHRLITLFYQAWRKHQATADLECGLQ
ADWRQMLLSLAGLGTLGLQNRLKKDGVNDDVFAYYAGRFGTRSLSEEGLRTLLTDYFSVPVEILPFQGRW
LKLDEADLLTLGRQNCTLGEWPVLGRQVWDAQSQFRIRLGPMSYQQFQPFLPGGKDFRALTKLVRFAIEI
AVTFDIQLVLAASEVPPCTLGDSQAGAARPGWIGWLGGRPARLGDADEVVLQASESGKPAR
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2512329-2513354 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGAACGACGCCCTGAGCCCAAAGTCCATGCTGGAGCAGCTGTATGCGCGGCCCTATGAGTTCGATTTTT
TTCAGGCCGTCAGGATACTGGAGCTGCAGCAGCTACGGTGTGGCTGCCAGGAGCTTCCGCTGCGCTTCCG
GACGCATCTCTCCCTGGCCACCCCGGCCAGCAGTGTCTATGCGCTGCAGCCGCCCGCGGCAGACCAGCCG
CAGGTCATGACCATCAACTTCATGGGGCTGACCGGTCCCTCTGGGGCGCTGCCGACGCGGTATACCGAGA
TGCTGCTGGCGCGTCGCCTGCAGCATCGGGATCAGACCGCCCACCACTTTTTTGATCTGCTCAATCACCG
TCTGATCACCCTGTTTTACCAGGCATGGCGCAAGCATCAGGCGACGGCCGATCTGGAGTGCGGCCTGCAG
GCCGACTGGCGCCAGATGCTGCTCTCCCTGGCCGGTCTGGGCACGCTGGGCCTGCAGAACCGGCTGAAAA
AAGACGGCGTCAATGACGATGTCTTTGCCTATTACGCCGGACGGTTCGGCACCCGCTCGCTCAGCGAGGA
GGGGCTGCGCACGCTGCTGACAGACTATTTTTCCGTGCCGGTCGAGATCCTGCCCTTTCAGGGCCGCTGG
CTGAAGCTGGATGAGGCGGACCTCCTCACTCTGGGGCGCCAAAACTGCACTCTGGGAGAGTGGCCGGTGC
TGGGGCGACAGGTATGGGATGCCCAAAGCCAGTTTAGGATCCGCCTCGGCCCCATGAGCTATCAGCAGTT
TCAGCCATTTTTGCCGGGGGGCAAGGACTTTCGGGCGCTGACCAAGCTGGTCCGTTTTGCCATCGAGATC
GCCGTCACATTCGATATTCAGCTGGTGCTGGCCGCCAGCGAGGTCCCCCCCTGCACGCTGGGCGATAGTC
AGGCCGGGGCGGCCCGTCCCGGATGGATTGGCTGGCTGGGAGGCCGTCCCGCCAGGCTGGGGGATGCCGA
CGAAGTGGTATTGCAGGCGTCAGAGTCCGGGAAGCCCGCGCGATAA