SecReT6
Protein ID: 387868335
SecReT6 ID597
T6SS typei4b
Gene symbolevpI
Locus tagETAF_2207
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2516085..2518070 [+]
Producttype VI secretion system protein EvpI
NoteTssI
UniProt IDE0T3X6
KEGG IDetd:ETAF_2207
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-79, Aligned region: 29..330
Phage_GPD [PF05954], Evalue: 7.60E-79, Aligned region: 360..378
Phage_base_V [PF04717], Evalue: 8.90E-24, Aligned region: 199..218
Phage_base_V [PF04717], Evalue: 8.90E-24, Aligned region: 366..458
Protein Sequence: 661 a.a.     [Download]
>gi|387868335|ref|YP_005699804.1| type VI secretion system protein EvpI [Edwardsiella tarda FL6-60]
MGLTSDSRLLSLSTPLGKDALQVVQCRGEEAIADLYRFELELFSTDPALAWQSLVGQAAALRLALPNGQT
RYWHGVIGRAAYRGAEQHGFAYYAELVPRLAWLQHAQECQIFQEKTVPQIIEAVLKARGISDFRLSLSQR
YAPREYCVQYRESDLSFISRLMEEEGIFYWFEHSESRHVLVLADGNAAVQPCKVRSDIVYRPKHRSESGD
DIQWWMPSLAVVPANVFLNAYTFEQPTAHLLTSSASVAKQGKLSDVAVYDFTDDYTQTREGERRAKLKME
GLEAMQARIEGGGRCRTLAPGYGFSLQKHFRKDCNGDYLLLSVRHEIVNNLPWQEQEVNYQNHFICLPKS
LPYRTLSQTPRPVIHGVQTAVVTGPQGEEIHTDRHGRVKVHFHWDRLGTQDDKSSCWIRVAQGWAGLGWG
GMQLPRVGQEVIVDFVDGNPDAPLITGRVYNAHQTPPFKLPDNKTQSGIQTRSTPNGNPEHFSLLRFEDK
MGAEEVFMQAERDFRRRVKHDDELTVEHDRRVTIKNDCAETVSEGNYLQSITKGKHTRVIEGDALTEVKS
GNSTLQVNKGDHATTASAGSLHLKAGTAITLSVGSNRIVIDSGGVLIEGMNITVKGKQSIALSGLSVAIT
GTQSASLSSSAEAEVSSSVMTSIKGGIVKIN
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2516085-2518070 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGGGATTAACGTCGGATAGCCGGCTGTTGTCCTTGTCCACCCCGCTGGGCAAGGATGCCTTACAGGTGG
TGCAGTGCCGGGGCGAAGAGGCGATCGCCGATCTCTACCGCTTTGAGCTGGAGCTGTTCTCCACGGACCC
CGCGCTGGCGTGGCAATCGCTGGTCGGGCAGGCCGCCGCGCTGCGGCTGGCCTTGCCGAATGGCCAGACC
CGCTACTGGCATGGCGTGATCGGCCGGGCCGCCTACCGGGGCGCCGAGCAACACGGATTTGCCTATTATG
CCGAGCTGGTACCGCGCCTGGCCTGGCTGCAGCACGCCCAGGAGTGTCAGATCTTCCAGGAGAAGACGGT
CCCGCAGATTATTGAAGCGGTGCTTAAGGCGCGGGGCATCAGCGATTTTCGCCTCTCGCTGTCGCAGCGC
TACGCCCCCCGGGAATACTGCGTACAGTATCGCGAATCGGACCTCAGCTTCATCAGCCGACTGATGGAGG
AAGAGGGCATTTTCTACTGGTTCGAACACAGCGAAAGCCGCCATGTGCTGGTATTGGCCGATGGCAATGC
CGCGGTCCAACCCTGCAAGGTGCGCTCAGACATCGTCTATCGACCTAAGCATAGGAGCGAATCCGGCGAT
GATATCCAGTGGTGGATGCCCTCCCTCGCGGTCGTGCCGGCCAACGTCTTCCTGAATGCCTATACCTTTG
AGCAGCCGACCGCCCATTTGCTGACCTCCAGCGCCTCCGTGGCCAAGCAGGGCAAATTGAGCGACGTGGC
GGTCTACGATTTCACCGATGACTATACGCAGACCCGGGAGGGCGAACGCCGCGCCAAGCTGAAGATGGAG
GGGCTAGAGGCCATGCAGGCCCGGATAGAGGGCGGCGGACGCTGCCGCACGCTGGCGCCGGGCTATGGGT
TCAGCCTGCAAAAACATTTCCGCAAAGACTGTAACGGTGACTATCTGCTGCTAAGCGTACGGCACGAGAT
CGTCAACAACCTGCCGTGGCAGGAGCAAGAGGTGAACTACCAGAACCACTTTATCTGTCTCCCCAAATCC
CTGCCCTACCGCACCCTAAGCCAAACGCCCCGCCCGGTGATCCATGGCGTACAGACTGCCGTGGTCACCG
GTCCGCAGGGCGAGGAGATCCATACCGATCGGCATGGCCGGGTTAAGGTTCATTTTCACTGGGATCGCCT
GGGAACGCAGGATGATAAAAGCTCCTGCTGGATCCGGGTGGCGCAGGGCTGGGCCGGGCTGGGCTGGGGG
GGGATGCAGCTGCCCCGCGTAGGGCAGGAGGTGATCGTGGATTTTGTCGATGGCAATCCGGACGCCCCCC
TGATCACCGGCCGGGTCTATAACGCCCACCAGACGCCCCCCTTCAAGCTGCCTGACAATAAGACCCAAAG
CGGTATTCAGACCCGCAGCACCCCCAATGGCAATCCGGAGCACTTCAGCCTGCTGCGCTTCGAGGACAAG
ATGGGGGCGGAAGAGGTGTTCATGCAGGCGGAGCGGGATTTTCGCCGCCGGGTGAAACACGATGACGAAC
TGACGGTCGAGCACGACCGCCGGGTGACCATCAAGAATGACTGCGCCGAGACGGTCTCCGAGGGGAACTA
CCTGCAGAGCATCACCAAGGGCAAGCATACCCGGGTGATCGAGGGCGATGCCCTCACGGAGGTGAAGTCA
GGCAACAGTACGCTGCAGGTGAACAAGGGGGATCACGCCACCACCGCCTCGGCGGGCAGCCTCCATCTGA
AGGCAGGAACCGCGATAACCCTGAGCGTGGGCAGCAATCGTATCGTCATTGACAGCGGCGGCGTGCTCAT
CGAGGGCATGAATATCACGGTGAAGGGGAAACAGTCCATTGCGCTATCCGGCCTCAGCGTCGCGATAACG
GGCACCCAATCGGCCAGCCTGAGCAGTTCGGCAGAGGCGGAGGTCTCCTCGTCCGTGATGACCTCCATCA
AGGGCGGTATTGTCAAGATCAACTGA