SecReT6
Protein ID: 387868337
SecReT6 ID597
T6SS typei4b
Gene symbolevpK
Locus tagETAF_2209
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2518481..2519548 [+]
Producttype VI secretion system protein EvpK
NoteTssA
UniProt IDE0T3X8
KEGG IDetd:ETAF_2209
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 237..252
Herpes_UL17 [PF04559], Evalue: 0.0046, Aligned region: 158..253
Protein Sequence: 355 a.a.     [Download]
>gi|387868337|ref|YP_005699806.1| type VI secretion system protein EvpK [Edwardsiella tarda FL6-60]
MTILDMARLLAPIGEAHPAGEDISFDPLYDQIREARRADADYLGQGEWVSSLKQANWVEVIRLTSEALAT
RSKDLQLAVWLCEALVQRHGLPGLREGLLLLDSLLERYWAEMYPALSDGDLEGRVSRLEWLNQILPPALG
LLPLTAAQDGRAYGWLDWQVSREVDNLKRLNNEAAQAALSEGKLDPDAWDLAVSHTPGAFYLTLQDDLQQ
AIRAFQGLSQRLDPLFGRDAPRISDVAERLEQMLRLVTRLVEGKGMARPREAQERAEAPAGAETAAVNAS
SPGVAGAPRTREEAIRQLSGIAAFFKETEPHSPVSYIVDKAARWGNMRLDEWIREVVEDDGTRRMLKGVL
GYDEE
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2518481-2519548 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGACTATCTTAGATATGGCGCGCTTGCTGGCCCCGATCGGTGAAGCTCATCCGGCGGGAGAGGATATCA
GCTTCGACCCGCTGTATGACCAGATTCGGGAGGCCCGCCGGGCCGATGCCGACTACCTTGGGCAGGGAGA
GTGGGTCAGCTCGCTCAAGCAGGCCAACTGGGTCGAGGTGATCCGCCTGACCAGCGAGGCGCTGGCGACG
CGCAGCAAAGATCTGCAGCTGGCGGTGTGGCTGTGCGAAGCCCTGGTGCAGCGGCATGGGCTGCCGGGGC
TGCGCGAGGGGCTGCTGTTACTGGATAGCCTGCTGGAGCGCTATTGGGCGGAGATGTATCCGGCGCTGAG
CGACGGGGATCTGGAGGGGCGGGTGAGCCGTCTGGAGTGGCTCAATCAGATCCTTCCCCCGGCGCTGGGC
TTGCTGCCCCTGACGGCCGCCCAGGATGGACGCGCCTACGGCTGGCTGGATTGGCAGGTCTCCCGAGAGG
TCGATAACCTGAAGCGGCTGAACAATGAGGCGGCTCAGGCGGCCCTCAGCGAAGGAAAGCTGGATCCGGA
TGCCTGGGATCTCGCCGTCAGCCATACGCCCGGCGCCTTTTACCTGACGTTACAGGACGATCTGCAGCAG
GCCATCCGCGCATTCCAGGGATTATCCCAGCGGCTCGACCCCCTATTTGGGCGGGATGCCCCGCGGATCA
GCGATGTGGCTGAGCGGCTGGAGCAGATGCTCAGGCTGGTGACGCGGCTGGTAGAGGGTAAGGGCATGGC
GCGACCCCGCGAGGCCCAGGAGCGCGCAGAGGCGCCGGCGGGCGCAGAGACCGCCGCGGTTAACGCTTCC
TCTCCCGGCGTGGCCGGCGCCCCCCGAACCCGCGAGGAGGCCATTCGGCAGCTCAGCGGCATCGCCGCGT
TTTTCAAGGAGACCGAACCGCACAGCCCCGTCTCCTACATCGTGGATAAAGCCGCCCGCTGGGGCAATAT
GCGACTGGATGAGTGGATCCGAGAGGTGGTGGAAGATGACGGCACCCGGCGGATGCTCAAAGGTGTATTG
GGCTATGATGAAGAATAA