SecReT6
Protein ID: 387868339
SecReT6 ID597
T6SS typei4b
Gene symbolevpM
Locus tagETAF_2211
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2520276..2521664 [+]
Producttype VI secretion system protein EvpM
NoteTssK
UniProt IDE0T3Y0
KEGG IDetd:ETAF_2211
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-90, Aligned region: 19..460
Protein Sequence: 462 a.a.     [Download]
>gi|387868339|ref|YP_005699808.1| type VI secretion system protein EvpM [Edwardsiella tarda FL6-60]
MKIHKPVYWHQGMFLQPQHFQLADLHSQFQLKPFLDSGLQDFWGVGALTISESALGNQQLNILSAELLFR
DHSYVVWPGNTICKPRSFASAWQDQSRPFNVYLGLKKLDTIESNVAVVPQLEDGAGRNVRCVTTQQGDKH
ADLYSDGPEAEIQSLHYVLQVLWESEVEKLTDYNILPIARLERQGEVVQLSKSFIPPCYIMGGSETLMRV
VRDVRDDLAGRARQLEAYKSPREIRKAEFDASFLMFLLALRTLNRYVPLLYQLTESPQVHPRKVYDMLRQ
IVGELSTFSERCDMLGSSGENSPGLPPYRHQDIAPGLLTVRDLIIRLLNEISIGPDFLIALEPSGEYLTA
RLPKSLLEDRNRFYLIVRSDMAPDTLQAAFRARARLAEADALPLLIQRALPGITLTPLSSVPEGLPRRSC
SFYFQIDTQSEAWRQVAESCHVAFNWFDAPDDLKVELVGVSR
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2520276-2521664 Edwardsiella tarda FL6-60 chromosome, complete genome
ATGAAAATTCACAAACCAGTTTATTGGCATCAGGGCATGTTTTTACAGCCGCAGCATTTTCAGCTGGCAG
ACCTGCATAGCCAATTTCAGCTCAAGCCATTCTTGGACTCCGGACTGCAGGATTTTTGGGGAGTGGGAGC
GCTGACCATTTCGGAGTCAGCCCTAGGCAACCAGCAGCTCAATATCCTGTCGGCTGAGCTGCTCTTCCGC
GACCACAGCTATGTCGTATGGCCGGGCAATACCATCTGTAAGCCGCGCTCCTTCGCCTCTGCCTGGCAGG
ATCAGAGCCGGCCGTTCAATGTCTACCTGGGGCTGAAAAAGCTGGACACGATAGAGTCCAATGTGGCCGT
CGTGCCACAGCTTGAGGATGGCGCAGGGCGGAACGTCCGCTGCGTGACGACCCAGCAGGGAGACAAGCAC
GCGGACTTATATTCGGATGGGCCTGAAGCCGAGATCCAGAGCCTGCACTACGTGCTGCAGGTGCTGTGGG
AGAGCGAGGTTGAAAAGCTGACGGATTACAATATCCTGCCCATCGCCCGGCTGGAGCGCCAGGGCGAGGT
GGTTCAGCTGTCCAAGAGCTTCATTCCGCCGTGCTACATCATGGGCGGCTCCGAGACCCTGATGCGGGTG
GTCCGGGATGTCCGGGACGATCTGGCGGGGCGCGCCCGCCAACTGGAGGCCTATAAAAGCCCGCGCGAAA
TCCGCAAGGCGGAGTTCGATGCCAGCTTTCTGATGTTTCTGCTGGCCCTGCGCACCCTCAACCGCTACGT
GCCGCTGCTGTACCAGCTGACCGAATCGCCGCAGGTCCATCCGCGCAAGGTCTACGACATGCTGCGGCAG
ATCGTCGGCGAGCTGTCCACCTTCAGCGAGCGCTGCGACATGCTGGGCTCCAGCGGCGAAAACAGCCCGG
GGCTCCCCCCCTACCGCCATCAGGACATCGCGCCGGGGCTGTTAACCGTACGCGATCTGATTATTCGTTT
ATTGAATGAAATATCGATCGGACCCGATTTCCTGATCGCCCTGGAGCCGAGCGGGGAGTACCTGACGGCG
CGGCTCCCCAAGAGCCTGCTGGAAGATCGTAACCGCTTCTACCTGATCGTCCGCAGTGACATGGCGCCGG
ATACCCTGCAGGCCGCCTTCCGGGCCCGCGCCAGGCTGGCCGAGGCCGACGCATTGCCCTTACTGATCCA
GCGCGCCTTGCCGGGGATCACGCTGACGCCGCTATCGTCCGTTCCCGAAGGCTTGCCCCGGCGCTCCTGC
TCGTTTTATTTCCAGATCGATACCCAAAGTGAAGCCTGGCGGCAGGTCGCCGAGAGTTGCCACGTCGCGT
TCAACTGGTTCGATGCCCCAGATGACCTCAAAGTAGAATTGGTAGGAGTGAGCCGGTGA