SecReT6
Protein ID: 387868340
SecReT6 ID597
T6SS typei4b
Gene symbolevpN
Locus tagETAF_2212
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2521661..2522311 [+]
Producttype VI secretion system protein EvpN
NoteTssL
UniProt IDE0T3Y1
KEGG IDetd:ETAF_2212
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-39, Aligned region: 2..204
Protein Sequence: 216 a.a.     [Download]
>gi|387868340|ref|YP_005699809.1| type VI secretion system protein EvpN [Edwardsiella tarda FL6-60]
MSLSEAFIQPMLYVRQYLQAPEGEASLFRERLQSYLHHSQLRAQEAGESPAAIDSALYAVVAWMDETIMC
STWDGVATWRRDPLQASYFNTVCAGVDFFDKLTALSPEADDVREVYLLCLALGFEGRYAGPAGQTALTQI
RVHQLRDLHGEVWEASRRLFPEAYPRSSVTPTQQTRWLTQSRFTTIVVPLVILVALYGILNWVLYEYADL
ALEWLP
 
Nucleotide Sequence: 651 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2521661-2522311 Edwardsiella tarda FL6-60 chromosome, complete genome
GTGAGTTTATCGGAAGCGTTTATTCAGCCCATGCTCTACGTGCGGCAGTATCTCCAGGCGCCCGAAGGCG
AGGCGTCATTATTCCGTGAGCGGCTGCAGTCATACCTGCACCACAGCCAGCTCCGGGCCCAAGAGGCGGG
GGAAAGTCCGGCCGCGATCGACTCCGCCCTGTATGCCGTTGTGGCCTGGATGGATGAGACCATCATGTGT
TCGACGTGGGACGGCGTGGCGACATGGCGACGTGACCCCCTGCAGGCCAGCTACTTCAACACCGTCTGCG
CCGGGGTTGACTTCTTCGACAAGCTGACCGCCCTGAGCCCCGAGGCCGATGACGTCAGGGAGGTCTATCT
GCTGTGCCTGGCCCTGGGATTTGAGGGGCGCTATGCCGGCCCGGCGGGCCAGACCGCGCTGACGCAGATC
AGGGTGCACCAGCTGAGGGATCTGCACGGCGAGGTATGGGAGGCGTCGCGACGTTTATTTCCAGAGGCCT
ACCCGAGATCCTCGGTCACGCCGACGCAGCAAACGCGATGGCTGACCCAAAGCCGCTTTACCACCATCGT
CGTGCCGCTGGTCATCCTGGTCGCCCTGTACGGCATTTTAAACTGGGTATTATATGAATACGCGGATCTC
GCGCTGGAGTGGCTGCCATGA