SecReT6
Protein ID: 387870027
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00646
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]712820..713338 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD2T454
KEGG IDepr:EPYR_00646
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.70E-30, Aligned region: 22..143
Protein Sequence: 172 a.a.     [Download]
>gi|387870027|ref|YP_005801397.1| hypothetical protein EPYR_00646 [Erwinia pyrifoliae DSM 12163]
MTMHRLSISRLITQSFLLAAFTLLAGCVSSSRSVPAQYSLVFQAHPQINDSAPLKVRVLLLKSDADFMAA
DFYSLQTHPQAVLGQNLLNSEQFFLMPGQTDKKRVGQSSPEARYIGIMAEYQTLDGKKWRVSLPVPLPAE
RHFYQIWQGDADNLRADVIADINGVRVINARD
 
Nucleotide Sequence: 519 bp     [Download]
>gi|387869382|ref|NC_017390.1|:712820-713338 Erwinia pyrifoliae DSM 12163, complete genome
ATGACTATGCACAGACTCTCGATTTCTCGCCTGATAACTCAGTCGTTTTTACTGGCAGCGTTTACCCTGC
TGGCCGGTTGTGTTTCGTCTTCACGCAGTGTCCCCGCGCAATACAGCCTGGTTTTTCAGGCTCACCCTCA
GATCAATGATTCGGCTCCGCTAAAGGTGCGGGTGCTGTTGCTGAAGTCGGATGCGGATTTTATGGCGGCT
GATTTCTACTCGCTGCAAACCCATCCGCAGGCAGTGCTGGGGCAAAACCTGTTGAACAGTGAGCAGTTTT
TCCTGATGCCGGGGCAGACTGACAAAAAACGGGTCGGGCAGAGCAGCCCGGAGGCGCGTTATATCGGCAT
TATGGCGGAATATCAAACGCTTGATGGCAAAAAGTGGCGAGTTTCTTTGCCGGTGCCCCTTCCTGCCGAA
CGCCATTTTTATCAAATTTGGCAAGGGGATGCGGATAATCTGCGCGCCGACGTTATCGCCGATATCAACG
GTGTCCGTGTTATTAACGCCCGCGATTAA