SecReT6
Protein ID: 387870028
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00647
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]713358..714701 [+]
Producthypothetical protein
NoteTssK
UniProt IDD2T455
KEGG IDepr:EPYR_00647
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-140, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|387870028|ref|YP_005801398.1| hypothetical protein EPYR_00647 [Erwinia pyrifoliae DSM 12163]
MSKAEKVVWTEGMFLRPHHFQQSENYLQSTLRDWGQAQRPWLWGLHDIEFDKSMLRQGKVALLSASGLLP
DGTAFAFYNGHDAPPPLFIPDNLTQAKVVLALPARRGGREEVIFSEAGDSLARFISFEREVDDFNAMAVG
QAAVQFGRLRLRLMLESELSAEWTAIGVARISEKRSDHQLRLDASYIPPMLNAINQSQLMEYIGDIHALL
AQRSQQIGQRLQQPGRFNTADMVDFMLLTLINQQLGHISHVKSLPLVHPETLFHGWLVFAAELTSWMPSR
TPDAALPVYQHDDLAGCFSQLLLLLRQGLSQVMEENALQLPLTERSHGLNVATVPESSMVREFGFVLAVR
ANVPAEAIQTHFPAQMKVAPVTKIRDLVQLQLPGIMLRAMPAAPPQIPWHAGYNYFQLDKGSELWQEMEK
SGTFALHLAGEFPGLEMEFWAIRSHSV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|387869382|ref|NC_017390.1|:713358-714701 Erwinia pyrifoliae DSM 12163, complete genome
ATGAGCAAAGCAGAAAAAGTAGTCTGGACCGAAGGAATGTTTCTGCGTCCGCATCATTTTCAGCAGAGCG
AAAACTACCTGCAAAGCACGCTGCGCGACTGGGGACAGGCGCAGCGTCCGTGGCTTTGGGGTCTGCACGA
CATTGAATTTGATAAATCGATGCTGCGCCAGGGCAAAGTCGCGCTGCTCTCGGCCAGCGGCCTGCTGCCG
GACGGCACGGCGTTTGCCTTCTACAATGGTCACGACGCGCCACCGCCGCTCTTTATCCCCGATAATCTGA
CTCAGGCCAAAGTGGTACTGGCGCTGCCGGCAAGGCGCGGCGGGCGTGAAGAGGTGATCTTCAGCGAGGC
TGGTGATTCGCTGGCGCGCTTTATCAGCTTCGAGCGGGAAGTGGATGATTTTAACGCCATGGCGGTCGGT
CAGGCGGCGGTACAGTTTGGCCGTTTACGTCTGCGGCTGATGCTGGAAAGTGAACTGAGCGCCGAATGGA
CCGCCATCGGCGTGGCGCGCATCAGTGAAAAGCGCAGTGACCACCAACTGCGTCTGGACGCCAGCTATAT
CCCGCCGATGCTCAATGCCATCAACCAGTCGCAGCTGATGGAATACATAGGCGATATCCACGCCCTGCTG
GCGCAGCGCAGCCAGCAGATTGGCCAGCGCTTGCAGCAGCCTGGGCGCTTTAATACCGCCGACATGGTCG
ACTTTATGCTGCTGACGCTGATCAACCAGCAGCTGGGGCATATCAGCCATGTGAAAAGTCTGCCGCTTGT
CCATCCTGAAACGTTGTTTCACGGCTGGCTGGTGTTCGCGGCTGAACTGACCAGCTGGATGCCGTCGCGC
ACCCCGGACGCGGCGCTGCCGGTTTACCAACATGACGATCTGGCTGGTTGCTTTAGCCAGCTGCTGCTGC
TGCTACGTCAGGGGCTGTCGCAGGTGATGGAAGAGAATGCGCTGCAGCTGCCGCTGACCGAGCGCTCACA
CGGCCTGAACGTGGCTACGGTGCCGGAGTCCTCGATGGTGCGCGAGTTTGGCTTTGTGCTGGCGGTGCGC
GCCAACGTGCCGGCCGAAGCGATACAAACCCACTTCCCGGCGCAGATGAAAGTGGCTCCCGTCACCAAAA
TCCGCGATCTGGTCCAGCTGCAGCTGCCCGGCATTATGCTGCGGGCAATGCCGGCCGCTCCACCACAAAT
TCCGTGGCACGCTGGCTACAACTATTTTCAGCTCGATAAGGGCAGCGAACTGTGGCAGGAAATGGAAAAG
TCCGGCACCTTCGCGCTGCACCTGGCCGGCGAGTTCCCGGGGCTGGAGATGGAGTTCTGGGCAATCCGCA
GTCACTCAGTCTGA