SecReT6
Protein ID: 387870029
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00648
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]714719..715960 [+]
Producttype VI secretion system, core protein
NoteTssL
UniProt IDD2T456
KEGG IDepr:EPYR_00648
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 353..390
OmpA [PF00691], Evalue: 5.60E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|387870029|ref|YP_005801399.1| type VI secretion system, core protein [Erwinia pyrifoliae DSM 12163]
MIQERHSEAAQAGMGGANSHNPLVAAANPLLNAIPQIRHSISHPDPAGLRQRLVDEIRQFEMNCQRAGLP
WEVIIGARYCLCTALDEAAALTPWGGRGVWPGNGLLVTFHNETWGGEKFFQLLARLSQTPREQIALLELI
NFCLQLGFEGRYRVMDNGRSQLETIRQRLLQMIRSVRGGYAPPLSAHPEDHPVTRQLWRPVVPLWACTAV
VGFLACLLYILLNWRLGDYTSPVLASIYQTTLPEVSIHNPAPPQPAAVNLKTFLKPEIEQGLVVVRDEAD
RSVVTLKGDGLFTSASTDVRGRYAEVLDRVAAAMNNVSGRILVVGYSDNVPIRSARFASNYELSLARAQS
VSEQLQQHLTQPQRVKAEGRGDSNPLAPNNSAGNRARNRRVEITLLVSPGSTRAELNDMAQGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|387869382|ref|NC_017390.1|:714719-715960 Erwinia pyrifoliae DSM 12163, complete genome
ATGATACAGGAAAGACATTCTGAAGCCGCCCAGGCGGGTATGGGCGGTGCCAACAGCCATAATCCTCTGG
TGGCCGCAGCGAACCCGCTGCTGAACGCCATTCCACAGATTCGCCATTCGATTTCTCATCCCGATCCGGC
CGGTTTACGCCAGCGGCTGGTCGATGAGATCCGCCAGTTTGAAATGAACTGTCAGCGCGCCGGGCTGCCG
TGGGAAGTGATCATTGGCGCGCGTTACTGTCTGTGTACCGCGCTGGACGAAGCGGCGGCGCTTACCCCGT
GGGGCGGGCGCGGCGTCTGGCCCGGCAACGGGCTGCTGGTCACCTTTCACAACGAAACCTGGGGCGGCGA
GAAGTTTTTCCAGCTGCTGGCGCGTCTGTCGCAGACGCCACGCGAACAAATCGCCCTGCTGGAGCTGATT
AACTTCTGCCTGCAGCTGGGCTTTGAGGGGCGCTACCGGGTGATGGACAACGGGCGATCCCAGTTGGAAA
CCATCAGGCAGCGCCTGTTGCAGATGATCCGCTCGGTGCGCGGTGGCTATGCGCCGCCGCTGTCGGCACA
TCCGGAAGATCACCCGGTGACGCGTCAACTGTGGCGTCCGGTGGTGCCGCTGTGGGCCTGTACCGCTGTG
GTGGGCTTCCTCGCCTGCCTGCTCTATATTCTGCTCAACTGGCGGCTGGGCGACTATACCAGCCCGGTGC
TGGCCTCAATTTACCAGACGACCCTACCCGAAGTCAGTATTCACAATCCCGCGCCGCCGCAGCCAGCAGC
GGTTAACCTGAAAACTTTCCTGAAACCGGAAATTGAACAGGGGCTGGTGGTGGTGCGCGATGAAGCCGAC
CGCAGCGTGGTGACGCTGAAAGGTGACGGCCTGTTCACCTCCGCATCGACCGACGTGCGTGGCCGCTACG
CCGAGGTGCTGGATCGCGTTGCCGCCGCCATGAACAACGTCAGCGGCCGCATCCTGGTGGTGGGCTACAG
TGATAACGTACCGATCCGCAGCGCACGCTTTGCCTCCAACTACGAGCTTTCCCTGGCGCGTGCGCAGTCG
GTCAGCGAACAATTGCAGCAGCATCTGACGCAGCCGCAGCGGGTCAAAGCGGAAGGGCGTGGCGATAGCA
ATCCGCTTGCGCCGAATAACAGCGCCGGCAATCGCGCCCGCAACCGACGCGTAGAAATCACGCTGCTGGT
GTCACCGGGCAGTACCCGGGCCGAGCTGAACGACATGGCGCAAGGAAATTAA