SecReT6
Protein ID: 387870032
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00651
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]720341..721348 [+]
Producthypothetical protein
NoteTssA
UniProt IDD2T459
KEGG IDepr:EPYR_00651
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-19, Aligned region: 52..111
Protein Sequence: 335 a.a.     [Download]
>gi|387870032|ref|YP_005801402.1| hypothetical protein EPYR_00651 [Erwinia pyrifoliae DSM 12163]
MNLEALLAPVTPDRPCGENLEYDADYMAMDQASAGKAEQQFGDTIIPAEPADWNKVERLALDLLGRSKDL
RVMLALTRAWTQLRGLSGYADGLQLIQQALLLYWQPLWPSLEEDGVEDPFYRLNALAALGDKSALTGALR
QAPLLRYATDEISLRDACALLDGSKTECSGYPGGRARLQDELARGGQPGIEAVIKISERLLTIRETLTEQ
LGATALPEMEQLLKTINTVAAGCQATDLNTLIPQTETAASSATPPPAAQLHADWRSVQLGSRSDAQLMLE
KVKQYFSQHEPSHPAPLMIGRVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|387869382|ref|NC_017390.1|:720341-721348 Erwinia pyrifoliae DSM 12163, complete genome
ATGAATCTTGAAGCGCTGCTGGCCCCGGTCACGCCTGACCGCCCCTGTGGGGAAAACCTTGAATATGACG
CCGACTACATGGCGATGGACCAGGCCAGCGCCGGTAAAGCCGAACAGCAGTTTGGCGATACCATCATTCC
GGCGGAACCGGCGGACTGGAACAAAGTCGAGCGGCTGGCGCTGGATCTGCTGGGGCGCAGCAAAGATCTG
CGCGTGATGCTGGCGCTAACCCGCGCCTGGACCCAGCTGAGAGGGTTGAGCGGCTATGCCGACGGCCTGC
AGCTGATCCAGCAGGCGCTGCTGCTTTACTGGCAGCCGCTGTGGCCGTCACTGGAAGAAGATGGCGTAGA
GGATCCGTTTTACCGCCTTAACGCGCTGGCGGCGCTGGGGGACAAATCGGCACTGACCGGCGCGTTGCGC
CAGGCTCCGCTGCTGCGCTATGCCACCGACGAAATCAGTCTGCGTGACGCCTGTGCGCTGCTCGACGGCA
GCAAAACCGAATGCTCCGGCTATCCCGGTGGCCGCGCCCGCCTGCAGGATGAGCTGGCGCGTGGAGGGCA
GCCCGGTATTGAAGCGGTCATTAAGATAAGTGAGCGGTTACTGACAATTCGCGAGACCCTGACCGAACAG
CTGGGCGCTACGGCCCTGCCGGAAATGGAGCAGCTGCTGAAAACCATTAATACCGTGGCTGCCGGCTGTC
AGGCCACCGACCTCAACACCCTGATCCCCCAGACGGAAACCGCCGCCAGCAGCGCTACGCCGCCGCCCGC
CGCCCAGCTGCACGCCGACTGGCGCAGCGTGCAGCTGGGTTCGCGCAGCGATGCGCAGCTGATGCTGGAA
AAGGTCAAACAGTATTTCAGCCAGCACGAGCCAAGCCATCCCGCCCCGCTGATGATCGGGCGGGTACAAC
GCATGATAGAGCTGGACTTTATGGACATTATCCGCGATCTCGCCCCGGACGGCGTACACCAGCTGGAGAC
GATTTTCGGGCGTCGCGACCACTCATAG