SecReT6
Protein ID: 387870033
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00652
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]721411..721947 [+]
Producthypothetical protein
NoteTssB
UniProt IDD2T460
KEGG IDepr:EPYR_00652
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-59, Aligned region: 12..162
Protein Sequence: 178 a.a.     [Download]
>gi|387870033|ref|YP_005801403.1| hypothetical protein EPYR_00652 [Erwinia pyrifoliae DSM 12163]
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLDPQPGVDERKFLEIDVDN
FDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARKVEPLNQLLDARTQLANLLTYMDGK
NGAEELIGKILQDPTLLQSLSHLPKADDKAADDHGNKE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|387869382|ref|NC_017390.1|:721411-721947 Erwinia pyrifoliae DSM 12163, complete genome
ATGGCAGTCAGTAAATCCAGTGGGCAAAAATTCATTGCCCGTAACCGCGCGCCACGCGTGCAGATTGAGT
ACGACGTGGAAATCTATGGTGCGGAACGCAAAATCCAGCTGCCCTTCGTGATGGGCGTGATGTCCGACCT
GGTCGGGAAACCGCTGGATCCGCAGCCGGGCGTTGATGAACGTAAGTTCCTTGAAATCGACGTCGACAAC
TTCGACGAACGCATGAAGGCGCTCAAACCACGCGTGGCATTCCAGGCAGAAAACACCCTGACCGGAGAAG
GGCGTCTTAATATCGATCTGACCTTTAACAGCATGGAAGACTTCTCGCCGGATGCGGTGGCACGTAAAGT
CGAGCCACTCAATCAGCTGCTGGATGCCCGTACCCAGCTGGCTAACCTGCTGACCTATATGGATGGCAAA
AACGGTGCGGAAGAACTGATCGGCAAAATCCTGCAGGACCCGACGCTGCTGCAATCACTCAGCCATCTGC
CGAAAGCTGACGACAAGGCAGCCGACGACCACGGCAACAAGGAGTAA