SecReT6
Protein ID: 387870034
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00653
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]721951..723450 [+]
Producthypothetical protein
NoteTssC
UniProt IDD2T461
KEGG IDepr:EPYR_00653
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.90E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|387870034|ref|YP_005801404.1| hypothetical protein EPYR_00653 [Erwinia pyrifoliae DSM 12163]
MSNPFQQSGDLQQQAYSEDAFSALLNKEFRPKSDQARAAVESAVKTLAQQALENSVTVSNDAYRTIQALI
AEIDDKLSQQVNQIIHHEDFQQLEGAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVSWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHGPQDVELLSEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHGNYTWTN
AAYAMAANINRSFKDFGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|387869382|ref|NC_017390.1|:721951-723450 Erwinia pyrifoliae DSM 12163, complete genome
ATGAGCAACCCATTCCAACAGTCAGGCGATTTGCAGCAGCAGGCCTACAGCGAGGACGCGTTCAGCGCGC
TGCTGAATAAAGAGTTCCGCCCGAAAAGCGACCAGGCGCGCGCGGCGGTGGAAAGCGCGGTGAAAACCCT
TGCGCAGCAGGCGCTGGAAAATAGCGTTACCGTCTCCAACGATGCCTACCGCACCATCCAGGCGCTGATT
GCCGAGATCGACGACAAGCTTTCCCAGCAGGTCAACCAGATTATCCACCATGAAGACTTCCAGCAGCTGG
AAGGGGCGTGGCGCGGCCTGAGCTATCTGGTTAACAACACCGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCTAAGCAGGAGCTGGGCCGCACCCTGAAACGCTATAAGGGCGTCAGCTGGGATCAAAGC
CCGATCTTTAAGAAGATCTATGAGGAAGAGTACGGCCAGTTCGGCGGCGAACCCTTTGGCTGCCTGGTGG
GCGACTACTACTTCGATCACGGCCCACAGGACGTGGAGCTGCTAAGCGAAATGGCGCGTATCGGCTCTGC
CGCCCACTGTCCGTTTATCACCGGCACCGCGCCGGGAGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCC
AACCCGCGTGACCTGACCAAAATCTTCCAGAATACCGAATACGCCGCCTGGCGCAGCCTGCGTGAATCGG
AAGATGCGCGCTACCTCGGCCTGGTGATGCCGCGCTTCCTGTCGCGTCTGCCTTATGGCATCCGCACCAA
CCCGGTGGACAGCTTCGACTTTGAAGAGCAGACCGACGGCGCTAACCACGGCAACTACACCTGGACCAAC
GCCGCCTACGCGATGGCGGCCAATATCAACCGCTCGTTTAAAGATTTTGGCTGGTGTACCTCGATCCGTG
GCGTCGAGTCCGGCGGCGCGGTGGAAAACCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAATGCCCGACCGAAATCGCCATCAGCGACAGGCGTGAAGCCGAGCTGGCGAAAAACGGCTTTATG
CCGCTGGTGCACCGCAAGAACTCCGATTTTGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCGGCGG
AGTACCACGATGCCGACGCCACCGCTAACGCCCGACTGGCGGCGCGCCTGCCGTATCTGTTCGCCTGCTG
CCGCTTTGCTCACTACCTGAAGTGCATCGTGCGCGACAAGATTGGCTCCTTCCGCGAGCGCGACGAGATG
GAGCGCTGGCTGAACGACTGGGTGATGAACTACGTTGACGGTGACCCGGCTAACTCCTCGCAGGAAACCA
AATCACGCAAGCCGCTGGCTGCCGCTGAGGTGCAGGTGCAGGAGATCGAAGATAACCCGGGCTACTACGC
GGCCAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGTCTTACCGTGTCGCTGCGCCTGGTGTCCAAA
CTGCCGTCGCTGAAATCGAACGACGCGTGA