SecReT6
Protein ID: 387870036
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00655
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]723994..724476 [+]
Producttype VI secretion system, effector protein hcp
NoteTssD
UniProt IDD2T463
KEGG IDepr:EPYR_00655
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.00E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|387870036|ref|YP_005801406.1| type VI secretion system, effector protein hcp [Erwinia pyrifoliae DSM 12163]
MAIDMYLKVDGVTGESKDANHTGWIDVTSFSWGATQPGNMSVGGGGGAGKVNFNDLHVDAKIDKAVTALL
KNCASGKHVGKVEVSVCKAGGTQIEYTRITLEDVLVTRVEFSGAGNGETLGVTYAFQAAKVKQQYWEQST
TGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|387869382|ref|NC_017390.1|:723994-724476 Erwinia pyrifoliae DSM 12163, complete genome
ATGGCTATTGATATGTATTTGAAAGTTGACGGTGTTACCGGTGAATCTAAAGATGCTAACCACACCGGCT
GGATCGATGTGACTTCTTTCTCCTGGGGCGCTACCCAGCCGGGCAACATGTCCGTAGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTTAACGATCTGCACGTTGATGCAAAAATCGATAAAGCAGTTACCGCGCTGCTG
AAAAACTGCGCCAGCGGTAAGCACGTCGGTAAAGTAGAAGTTTCCGTATGTAAAGCGGGCGGCACTCAGA
TTGAGTACACCCGTATTACTCTGGAAGACGTGCTGGTAACCCGCGTCGAGTTCTCGGGTGCAGGAAACGG
GGAAACTTTGGGCGTAACCTACGCATTCCAGGCTGCCAAAGTGAAACAGCAGTACTGGGAGCAGAGCACC
ACCGGTGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATTAAAGAGAATAAAGAAGCGTAA